Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 5722286..5722900 Replicon chromosome
Accession NZ_CP124649
Organism Pseudomonas aeruginosa strain 2020CK-00218

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag P7I80_RS27240 Protein ID WP_071534354.1
Coordinates 5722718..5722900 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag P7I80_RS27235 Protein ID WP_012077229.1
Coordinates 5722286..5722690 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7I80_RS27210 (P7I80_27210) 5718426..5719136 + 711 WP_012074129.1 hypothetical protein -
P7I80_RS27215 (P7I80_27215) 5719133..5720053 + 921 WP_012074128.1 hypothetical protein -
P7I80_RS27220 (P7I80_27220) 5720050..5720589 + 540 WP_012074127.1 hypothetical protein -
P7I80_RS27225 (P7I80_27225) 5720589..5721287 + 699 WP_033896049.1 hypothetical protein -
P7I80_RS27230 (P7I80_27230) 5721272..5722243 + 972 WP_012077228.1 hypothetical protein -
P7I80_RS27235 (P7I80_27235) 5722286..5722690 - 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
P7I80_RS27240 (P7I80_27240) 5722718..5722900 - 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
P7I80_RS27245 (P7I80_27245) 5723443..5724375 - 933 WP_078451856.1 ZIP family metal transporter -
P7I80_RS27250 (P7I80_27250) 5724394..5725005 - 612 WP_003098862.1 superoxide dismutase -
P7I80_RS27255 (P7I80_27255) 5725018..5725467 - 450 WP_003094369.1 hypothetical protein -
P7I80_RS27260 (P7I80_27260) 5725495..5726871 - 1377 WP_023096113.1 class II fumarate hydratase FumC -
P7I80_RS27265 (P7I80_27265) 5726864..5727259 - 396 WP_003094374.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5685407..5722900 37493


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T280949 WP_071534354.1 NZ_CP124649:c5722900-5722718 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT280949 WP_012077229.1 NZ_CP124649:c5722690-5722286 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References