Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 2535064..2536106 Replicon chromosome
Accession NZ_CP124649
Organism Pseudomonas aeruginosa strain 2020CK-00218

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag P7I80_RS11995 Protein ID WP_003109777.1
Coordinates 2535531..2536106 (+) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag P7I80_RS11990 Protein ID WP_003050245.1
Coordinates 2535064..2535534 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7I80_RS11955 (P7I80_11955) 2530456..2531874 - 1419 WP_042178570.1 TIGR03752 family integrating conjugative element protein -
P7I80_RS11960 (P7I80_11960) 2531864..2532775 - 912 WP_003105643.1 TIGR03749 family integrating conjugative element protein -
P7I80_RS11965 (P7I80_11965) 2532772..2533464 - 693 WP_003105641.1 TIGR03746 family integrating conjugative element protein -
P7I80_RS11970 (P7I80_11970) 2533461..2533859 - 399 WP_003105639.1 TIGR03750 family conjugal transfer protein -
P7I80_RS11975 (P7I80_11975) 2533871..2534230 - 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
P7I80_RS11980 (P7I80_11980) 2534247..2534480 - 234 WP_003050225.1 TIGR03758 family integrating conjugative element protein -
P7I80_RS11985 (P7I80_11985) 2534477..2534860 - 384 WP_003120001.1 RAQPRD family integrative conjugative element protein -
P7I80_RS11990 (P7I80_11990) 2535064..2535534 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
P7I80_RS11995 (P7I80_11995) 2535531..2536106 + 576 WP_003109777.1 PIN domain-containing protein Toxin
P7I80_RS12000 (P7I80_12000) 2536124..2537038 + 915 WP_042178573.1 AAA family ATPase -
P7I80_RS12005 (P7I80_12005) 2537035..2537505 + 471 WP_003105626.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
P7I80_RS12010 (P7I80_12010) 2537502..2538002 + 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
P7I80_RS12015 (P7I80_12015) 2538002..2538904 + 903 WP_003105624.1 CBASS oligonucleotide cyclase -
P7I80_RS12020 (P7I80_12020) 2538943..2539668 + 726 WP_003050273.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2489006..2637233 148227


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21644.79 Da        Isoelectric Point: 5.6172

>T280946 WP_003109777.1 NZ_CP124649:2535531-2536106 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT280946 WP_003050245.1 NZ_CP124649:2535064-2535534 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References