Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 143407..143912 | Replicon | chromosome |
| Accession | NZ_CP124649 | ||
| Organism | Pseudomonas aeruginosa strain 2020CK-00218 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | P7I80_RS00665 | Protein ID | WP_003083773.1 |
| Coordinates | 143407..143688 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | P7I80_RS00670 | Protein ID | WP_003083775.1 |
| Coordinates | 143685..143912 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I80_RS00640 (P7I80_00640) | 138658..140007 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
| P7I80_RS00645 (P7I80_00645) | 140056..140742 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| P7I80_RS00650 (P7I80_00650) | 140843..141577 | + | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
| P7I80_RS00655 (P7I80_00655) | 141757..142167 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
| P7I80_RS00660 (P7I80_00660) | 142199..143107 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| P7I80_RS00665 (P7I80_00665) | 143407..143688 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| P7I80_RS00670 (P7I80_00670) | 143685..143912 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| P7I80_RS00675 (P7I80_00675) | 144088..144708 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| P7I80_RS00680 (P7I80_00680) | 144809..145309 | + | 501 | WP_003083778.1 | LEA type 2 family protein | - |
| P7I80_RS00685 (P7I80_00685) | 145382..145723 | + | 342 | WP_014603467.1 | zinc ribbon domain-containing protein YjdM | - |
| P7I80_RS00690 (P7I80_00690) | 145807..147234 | - | 1428 | WP_003083784.1 | GABA permease | - |
| P7I80_RS00695 (P7I80_00695) | 147403..148896 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T280943 WP_003083773.1 NZ_CP124649:c143688-143407 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|