Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 2667227..2667732 Replicon chromosome
Accession NZ_CP124648
Organism Pseudomonas aeruginosa strain 2020CK-00220

Toxin (Protein)


Gene name parE Uniprot ID A0A3S3VVC5
Locus tag P7I81_RS12535 Protein ID WP_031640969.1
Coordinates 2667227..2667508 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A1C7BDS9
Locus tag P7I81_RS12540 Protein ID WP_003083775.1
Coordinates 2667505..2667732 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7I81_RS12510 (P7I81_12510) 2662478..2663827 + 1350 WP_003137006.1 C4-dicarboxylate transporter DctA -
P7I81_RS12515 (P7I81_12515) 2663876..2664562 + 687 WP_003083762.1 FadR/GntR family transcriptional regulator -
P7I81_RS12520 (P7I81_12520) 2664663..2665397 + 735 WP_003128333.1 GntR family transcriptional regulator -
P7I81_RS12525 (P7I81_12525) 2665577..2665987 + 411 WP_003110659.1 aegerolysin family protein -
P7I81_RS12530 (P7I81_12530) 2666019..2666927 - 909 WP_003083769.1 LysR family transcriptional regulator -
P7I81_RS12535 (P7I81_12535) 2667227..2667508 - 282 WP_031640969.1 type II toxin-antitoxin system toxin ParE Toxin
P7I81_RS12540 (P7I81_12540) 2667505..2667732 - 228 WP_003083775.1 CopG family ribbon-helix-helix protein Antitoxin
P7I81_RS12545 (P7I81_12545) 2667908..2668531 - 624 WP_003137011.1 hypothetical protein -
P7I81_RS12550 (P7I81_12550) 2668632..2669132 + 501 WP_124089319.1 LEA type 2 family protein -
P7I81_RS12555 (P7I81_12555) 2669205..2669546 + 342 WP_003101229.1 zinc ribbon domain-containing protein YjdM -
P7I81_RS12560 (P7I81_12560) 2669628..2671055 - 1428 WP_003083784.1 GABA permease -
P7I81_RS12565 (P7I81_12565) 2671224..2672717 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10475.19 Da        Isoelectric Point: 10.0435

>T280940 WP_031640969.1 NZ_CP124648:c2667508-2667227 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLNLERWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8556.58 Da        Isoelectric Point: 5.5740

>AT280940 WP_003083775.1 NZ_CP124648:c2667732-2667505 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHTEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S3VVC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1C7BDS9

References