Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 2667227..2667732 | Replicon | chromosome |
Accession | NZ_CP124648 | ||
Organism | Pseudomonas aeruginosa strain 2020CK-00220 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A3S3VVC5 |
Locus tag | P7I81_RS12535 | Protein ID | WP_031640969.1 |
Coordinates | 2667227..2667508 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | P7I81_RS12540 | Protein ID | WP_003083775.1 |
Coordinates | 2667505..2667732 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I81_RS12510 (P7I81_12510) | 2662478..2663827 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
P7I81_RS12515 (P7I81_12515) | 2663876..2664562 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
P7I81_RS12520 (P7I81_12520) | 2664663..2665397 | + | 735 | WP_003128333.1 | GntR family transcriptional regulator | - |
P7I81_RS12525 (P7I81_12525) | 2665577..2665987 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
P7I81_RS12530 (P7I81_12530) | 2666019..2666927 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
P7I81_RS12535 (P7I81_12535) | 2667227..2667508 | - | 282 | WP_031640969.1 | type II toxin-antitoxin system toxin ParE | Toxin |
P7I81_RS12540 (P7I81_12540) | 2667505..2667732 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P7I81_RS12545 (P7I81_12545) | 2667908..2668531 | - | 624 | WP_003137011.1 | hypothetical protein | - |
P7I81_RS12550 (P7I81_12550) | 2668632..2669132 | + | 501 | WP_124089319.1 | LEA type 2 family protein | - |
P7I81_RS12555 (P7I81_12555) | 2669205..2669546 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
P7I81_RS12560 (P7I81_12560) | 2669628..2671055 | - | 1428 | WP_003083784.1 | GABA permease | - |
P7I81_RS12565 (P7I81_12565) | 2671224..2672717 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10475.19 Da Isoelectric Point: 10.0435
>T280940 WP_031640969.1 NZ_CP124648:c2667508-2667227 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLNLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLNLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S3VVC5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1C7BDS9 |