Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
| Location | 868004..868612 | Replicon | chromosome |
| Accession | NZ_CP124648 | ||
| Organism | Pseudomonas aeruginosa strain 2020CK-00220 | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | A0A444LUU5 |
| Locus tag | P7I81_RS04200 | Protein ID | WP_019486378.1 |
| Coordinates | 868004..868351 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | A0A0B0C355 |
| Locus tag | P7I81_RS04205 | Protein ID | WP_003114155.1 |
| Coordinates | 868361..868612 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I81_RS04170 (P7I81_04170) | 863423..863635 | + | 213 | WP_003085460.1 | cysteine-rich CWC family protein | - |
| P7I81_RS04175 (P7I81_04175) | 863635..864327 | + | 693 | WP_003085458.1 | 16S rRNA pseudouridine(516) synthase | - |
| P7I81_RS04180 (P7I81_04180) | 864463..865506 | + | 1044 | WP_003110811.1 | L,D-transpeptidase | - |
| P7I81_RS04185 (P7I81_04185) | 865586..866323 | + | 738 | WP_023130192.1 | murein L,D-transpeptidase catalytic domain family protein | - |
| P7I81_RS04190 (P7I81_04190) | 866775..867677 | + | 903 | WP_003085447.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
| P7I81_RS04200 (P7I81_04200) | 868004..868351 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I81_RS04205 (P7I81_04205) | 868361..868612 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P7I81_RS04210 (P7I81_04210) | 868826..869809 | - | 984 | WP_058174561.1 | tyrosine-type recombinase/integrase | - |
| P7I81_RS04215 (P7I81_04215) | 869809..871101 | - | 1293 | WP_100212560.1 | hypothetical protein | - |
| P7I81_RS04220 (P7I81_04220) | 871359..872621 | - | 1263 | WP_034049230.1 | zonular occludens toxin domain-containing protein | - |
| P7I81_RS04225 (P7I81_04225) | 872623..872973 | - | 351 | WP_003159569.1 | DUF2523 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | catB7 | - | 868004..890529 | 22525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T280938 WP_019486378.1 NZ_CP124648:c868351-868004 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A444LUU5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B0C355 |