Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 6710742..6711435 | Replicon | chromosome |
Accession | NZ_CP124646 | ||
Organism | Pseudomonas aeruginosa strain 2020CK-00185 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | P7I78_RS31265 | Protein ID | WP_003151133.1 |
Coordinates | 6710742..6711119 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | P7I78_RS31270 | Protein ID | WP_001172026.1 |
Coordinates | 6711100..6711435 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I78_RS31245 (P7I78_31245) | 6705895..6706440 | - | 546 | WP_182330315.1 | hypothetical protein | - |
P7I78_RS31250 (P7I78_31250) | 6706433..6706723 | - | 291 | WP_225850518.1 | hypothetical protein | - |
P7I78_RS31255 (P7I78_31255) | 6706935..6709964 | - | 3030 | WP_065761565.1 | Tn3 family transposase | - |
P7I78_RS31260 (P7I78_31260) | 6709948..6710550 | - | 603 | WP_010465829.1 | recombinase family protein | - |
P7I78_RS31265 (P7I78_31265) | 6710742..6711119 | + | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I78_RS31270 (P7I78_31270) | 6711100..6711435 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
P7I78_RS31275 (P7I78_31275) | 6711450..6711785 | + | 336 | WP_000741275.1 | hypothetical protein | - |
P7I78_RS31280 (P7I78_31280) | 6711809..6712135 | + | 327 | WP_000091614.1 | hypothetical protein | - |
P7I78_RS31285 (P7I78_31285) | 6712132..6712512 | + | 381 | WP_001054412.1 | hypothetical protein | - |
P7I78_RS31290 (P7I78_31290) | 6712669..6713052 | + | 384 | WP_282415613.1 | DUF3391 domain-containing protein | - |
P7I78_RS31295 (P7I78_31295) | 6713136..6714005 | + | 870 | WP_223198360.1 | HD-GYP domain-containing protein | - |
P7I78_RS31300 (P7I78_31300) | 6714779..6715186 | - | 408 | WP_023383747.1 | hypothetical protein | - |
P7I78_RS31305 (P7I78_31305) | 6715223..6715915 | - | 693 | WP_023383746.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | blaIMP-15 / blaOXA-2 / catB2 | - | 6640653..6900395 | 259742 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T280936 WP_003151133.1 NZ_CP124646:6710742-6711119 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |