Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-DUF971 |
Location | 6698012..6698610 | Replicon | chromosome |
Accession | NZ_CP124646 | ||
Organism | Pseudomonas aeruginosa strain 2020CK-00185 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | P7I78_RS31190 | Protein ID | WP_048388330.1 |
Coordinates | 6698012..6698314 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P7I78_RS31195 | Protein ID | WP_042857721.1 |
Coordinates | 6698311..6698610 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I78_RS31160 (P7I78_31160) | 6694336..6694578 | - | 243 | WP_047303031.1 | hypothetical protein | - |
P7I78_RS31165 (P7I78_31165) | 6694725..6695816 | - | 1092 | WP_282415508.1 | hypothetical protein | - |
P7I78_RS31170 (P7I78_31170) | 6695882..6696100 | - | 219 | WP_047303033.1 | hypothetical protein | - |
P7I78_RS31175 (P7I78_31175) | 6696157..6696474 | - | 318 | WP_047303035.1 | hypothetical protein | - |
P7I78_RS31180 (P7I78_31180) | 6696507..6696875 | - | 369 | WP_047303037.1 | hypothetical protein | - |
P7I78_RS31185 (P7I78_31185) | 6697029..6697808 | - | 780 | WP_182330310.1 | DUF4942 domain-containing protein | - |
P7I78_RS31190 (P7I78_31190) | 6698012..6698314 | + | 303 | WP_048388330.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I78_RS31195 (P7I78_31195) | 6698311..6698610 | + | 300 | WP_042857721.1 | putative addiction module antidote protein | Antitoxin |
P7I78_RS31200 (P7I78_31200) | 6698633..6698956 | + | 324 | WP_048388333.1 | hypothetical protein | - |
P7I78_RS31205 (P7I78_31205) | 6698969..6699190 | + | 222 | WP_048388335.1 | hypothetical protein | - |
P7I78_RS31210 (P7I78_31210) | 6699192..6699509 | + | 318 | WP_152690486.1 | hypothetical protein | - |
P7I78_RS31215 (P7I78_31215) | 6700618..6700893 | - | 276 | WP_134286862.1 | hypothetical protein | - |
P7I78_RS31220 (P7I78_31220) | 6700922..6701875 | - | 954 | WP_052960123.1 | non-homologous end-joining DNA ligase | - |
P7I78_RS31225 (P7I78_31225) | 6702014..6702445 | + | 432 | WP_047306860.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | blaIMP-15 / blaOXA-2 / catB2 | - | 6640653..6900395 | 259742 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11261.85 Da Isoelectric Point: 10.3903
>T280935 WP_048388330.1 NZ_CP124646:6698012-6698314 [Pseudomonas aeruginosa]
MKTIKQTATYRNWERKLRDKQAKAIIAARVFRVAHGLLGDVQPVGQGISELRIHHGPGYRVYFQQRGNQLVLLLCGGDKS
SQARDIETAKALASQWSDDE
MKTIKQTATYRNWERKLRDKQAKAIIAARVFRVAHGLLGDVQPVGQGISELRIHHGPGYRVYFQQRGNQLVLLLCGGDKS
SQARDIETAKALASQWSDDE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|