Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tad-ata/COG5606-COG4679
Location 6675734..6676427 Replicon chromosome
Accession NZ_CP124646
Organism Pseudomonas aeruginosa strain 2020CK-00185

Toxin (Protein)


Gene name tad Uniprot ID N2IHR9
Locus tag P7I78_RS31065 Protein ID WP_003151133.1
Coordinates 6676050..6676427 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name ata Uniprot ID N2IIN5
Locus tag P7I78_RS31060 Protein ID WP_001172026.1
Coordinates 6675734..6676069 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7I78_RS31015 (P7I78_31015) 6671284..6671838 + 555 WP_003159191.1 aminoglycoside N-acetyltransferase AAC(6')-Ib4 -
P7I78_RS31020 (P7I78_31020) 6671932..6672222 + 291 WP_000470556.1 DUF1010 domain-containing protein -
P7I78_RS31025 (P7I78_31025) 6672558..6673190 + 633 WP_012477387.1 type B-2 chloramphenicol O-acetyltransferase CatB2 -
P7I78_RS31030 (P7I78_31030) 6673284..6673574 + 291 WP_000470556.1 DUF1010 domain-containing protein -
P7I78_RS31035 (P7I78_31035) 6673679..6674026 + 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
P7I78_RS31040 (P7I78_31040) 6674020..6674637 + 618 Protein_6129 dihydropteroate synthase -
P7I78_RS31045 (P7I78_31045) 6674677..6675018 - 342 WP_025999701.1 hypothetical protein -
P7I78_RS31050 (P7I78_31050) 6675034..6675360 - 327 WP_000091614.1 hypothetical protein -
P7I78_RS31055 (P7I78_31055) 6675384..6675719 - 336 WP_000741275.1 hypothetical protein -
P7I78_RS31060 (P7I78_31060) 6675734..6676069 - 336 WP_001172026.1 helix-turn-helix transcriptional regulator Antitoxin
P7I78_RS31065 (P7I78_31065) 6676050..6676427 - 378 WP_003151133.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P7I78_RS31070 (P7I78_31070) 6676619..6677221 + 603 WP_010465829.1 recombinase family protein -
P7I78_RS31075 (P7I78_31075) 6677205..6680234 + 3030 WP_010799689.1 Tn3 family transposase -
P7I78_RS31080 (P7I78_31080) 6680265..6680507 - 243 Protein_6137 TniQ family protein -
P7I78_RS31085 (P7I78_31085) 6680504..6681412 - 909 WP_003465065.1 TniB family NTP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element blaIMP-15 / blaOXA-2 / catB2 - 6640653..6900395 259742
- inside IScluster/Tn blaIMP-15 / blaOXA-2 / catB2 - 6660602..6685811 25209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(16-109)

Antitoxin

Cro/C1-type helix-turn-helix domain

(40-93)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13705.78 Da        Isoelectric Point: 9.4693

>T280934 WP_003151133.1 NZ_CP124646:c6676427-6676050 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH

Download         Length: 378 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12201.39 Da        Isoelectric Point: 10.6058

>AT280934 WP_001172026.1 NZ_CP124646:c6676069-6675734 [Pseudomonas aeruginosa]
MQKRIIEGVEVQRSSGNVFADLGLPDAEKLKIKTGLVVEIRRAMRALGLTQQAAAKRMGIPQPKVSGMMRGDFTNLSERK
LMDCLNRLGYDIEIKVRPAAEPIGHLTLATA

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A024ELN5

Antitoxin

Source ID Structure
AlphaFold DB A0A024EKI7

References