Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 6675734..6676427 | Replicon | chromosome |
| Accession | NZ_CP124646 | ||
| Organism | Pseudomonas aeruginosa strain 2020CK-00185 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | N2IHR9 |
| Locus tag | P7I78_RS31065 | Protein ID | WP_003151133.1 |
| Coordinates | 6676050..6676427 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | N2IIN5 |
| Locus tag | P7I78_RS31060 | Protein ID | WP_001172026.1 |
| Coordinates | 6675734..6676069 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I78_RS31015 (P7I78_31015) | 6671284..6671838 | + | 555 | WP_003159191.1 | aminoglycoside N-acetyltransferase AAC(6')-Ib4 | - |
| P7I78_RS31020 (P7I78_31020) | 6671932..6672222 | + | 291 | WP_000470556.1 | DUF1010 domain-containing protein | - |
| P7I78_RS31025 (P7I78_31025) | 6672558..6673190 | + | 633 | WP_012477387.1 | type B-2 chloramphenicol O-acetyltransferase CatB2 | - |
| P7I78_RS31030 (P7I78_31030) | 6673284..6673574 | + | 291 | WP_000470556.1 | DUF1010 domain-containing protein | - |
| P7I78_RS31035 (P7I78_31035) | 6673679..6674026 | + | 348 | WP_000679427.1 | quaternary ammonium compound efflux SMR transporter QacE delta 1 | - |
| P7I78_RS31040 (P7I78_31040) | 6674020..6674637 | + | 618 | Protein_6129 | dihydropteroate synthase | - |
| P7I78_RS31045 (P7I78_31045) | 6674677..6675018 | - | 342 | WP_025999701.1 | hypothetical protein | - |
| P7I78_RS31050 (P7I78_31050) | 6675034..6675360 | - | 327 | WP_000091614.1 | hypothetical protein | - |
| P7I78_RS31055 (P7I78_31055) | 6675384..6675719 | - | 336 | WP_000741275.1 | hypothetical protein | - |
| P7I78_RS31060 (P7I78_31060) | 6675734..6676069 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P7I78_RS31065 (P7I78_31065) | 6676050..6676427 | - | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I78_RS31070 (P7I78_31070) | 6676619..6677221 | + | 603 | WP_010465829.1 | recombinase family protein | - |
| P7I78_RS31075 (P7I78_31075) | 6677205..6680234 | + | 3030 | WP_010799689.1 | Tn3 family transposase | - |
| P7I78_RS31080 (P7I78_31080) | 6680265..6680507 | - | 243 | Protein_6137 | TniQ family protein | - |
| P7I78_RS31085 (P7I78_31085) | 6680504..6681412 | - | 909 | WP_003465065.1 | TniB family NTP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | blaIMP-15 / blaOXA-2 / catB2 | - | 6640653..6900395 | 259742 | |
| - | inside | IScluster/Tn | blaIMP-15 / blaOXA-2 / catB2 | - | 6660602..6685811 | 25209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T280934 WP_003151133.1 NZ_CP124646:c6676427-6676050 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024ELN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024EKI7 |