Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 1451281..1451921 Replicon chromosome
Accession NZ_CP124646
Organism Pseudomonas aeruginosa strain 2020CK-00185

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag P7I78_RS06880 Protein ID WP_003134109.1
Coordinates 1451511..1451921 (+) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag P7I78_RS06875 Protein ID WP_031634724.1
Coordinates 1451281..1451511 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7I78_RS06855 (P7I78_06855) 1447012..1447761 + 750 WP_031297278.1 IS21-like element helper ATPase IstB -
P7I78_RS06860 (P7I78_06860) 1447778..1448368 - 591 WP_282415553.1 hypothetical protein -
P7I78_RS06865 (P7I78_06865) 1448589..1448798 - 210 WP_003105733.1 cold-shock protein -
P7I78_RS06870 (P7I78_06870) 1449106..1451025 - 1920 WP_004352838.1 type I DNA topoisomerase -
P7I78_RS06875 (P7I78_06875) 1451281..1451511 + 231 WP_031634724.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P7I78_RS06880 (P7I78_06880) 1451511..1451921 + 411 WP_003134109.1 tRNA(fMet)-specific endonuclease VapC Toxin
P7I78_RS06885 (P7I78_06885) 1451937..1452134 + 198 WP_023083219.1 hypothetical protein -
P7I78_RS06890 (P7I78_06890) 1452148..1452366 + 219 WP_023083218.1 hypothetical protein -
P7I78_RS06895 (P7I78_06895) 1452432..1452599 - 168 WP_128729268.1 CrpP family ICE-associated protein -
P7I78_RS06900 (P7I78_06900) 1452755..1453243 - 489 WP_004352840.1 single-stranded DNA-binding protein -
P7I78_RS06905 (P7I78_06905) 1453273..1454112 - 840 WP_003105750.1 Rha family transcriptional regulator -
P7I78_RS06910 (P7I78_06910) 1454159..1454707 - 549 WP_004352841.1 DUF3158 family protein -
P7I78_RS06915 (P7I78_06915) 1454713..1455441 - 729 WP_004352842.1 TIGR03761 family integrating conjugative element protein -
P7I78_RS06920 (P7I78_06920) 1455598..1456167 - 570 WP_225316301.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-33)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15452.78 Da        Isoelectric Point: 7.3233

>T280929 WP_003134109.1 NZ_CP124646:1451511-1451921 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8420.29 Da        Isoelectric Point: 4.2821

>AT280929 WP_031634724.1 NZ_CP124646:1451281-1451511 [Pseudomonas aeruginosa]
VEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVAVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References