Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 143226..143731 | Replicon | chromosome |
Accession | NZ_CP124646 | ||
Organism | Pseudomonas aeruginosa strain 2020CK-00185 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | P7I78_RS00655 | Protein ID | WP_003083773.1 |
Coordinates | 143226..143507 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A0H2ZJU8 |
Locus tag | P7I78_RS00660 | Protein ID | WP_003137009.1 |
Coordinates | 143504..143731 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I78_RS00630 (P7I78_00630) | 138477..139826 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
P7I78_RS00635 (P7I78_00635) | 139875..140561 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
P7I78_RS00640 (P7I78_00640) | 140662..141396 | + | 735 | WP_003110658.1 | GntR family transcriptional regulator | - |
P7I78_RS00645 (P7I78_00645) | 141576..141986 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
P7I78_RS00650 (P7I78_00650) | 142018..142926 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
P7I78_RS00655 (P7I78_00655) | 143226..143507 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
P7I78_RS00660 (P7I78_00660) | 143504..143731 | - | 228 | WP_003137009.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P7I78_RS00665 (P7I78_00665) | 143907..144530 | - | 624 | WP_003137011.1 | hypothetical protein | - |
P7I78_RS00670 (P7I78_00670) | 144631..145131 | + | 501 | WP_003137013.1 | LEA type 2 family protein | - |
P7I78_RS00675 (P7I78_00675) | 145203..145544 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
P7I78_RS00680 (P7I78_00680) | 145626..147053 | - | 1428 | WP_003137015.1 | GABA permease | - |
P7I78_RS00685 (P7I78_00685) | 147222..148715 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T280927 WP_003083773.1 NZ_CP124646:c143507-143226 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|