Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 6053800..6054384 | Replicon | chromosome |
Accession | NZ_CP124641 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01198 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P7I90_RS28200 | Protein ID | WP_033996895.1 |
Coordinates | 6054094..6054384 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P7I90_RS28195 | Protein ID | WP_033996897.1 |
Coordinates | 6053800..6054093 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I90_RS28165 (P7I90_28165) | 6049150..6049383 | + | 234 | WP_033996905.1 | hypothetical protein | - |
P7I90_RS28170 (P7I90_28170) | 6049403..6052120 | + | 2718 | WP_033996995.1 | toprim domain-containing protein | - |
P7I90_RS28175 (P7I90_28175) | 6052165..6052308 | + | 144 | WP_153576040.1 | hypothetical protein | - |
P7I90_RS28180 (P7I90_28180) | 6052359..6052934 | + | 576 | WP_052157654.1 | hypothetical protein | - |
P7I90_RS28185 (P7I90_28185) | 6053126..6053296 | + | 171 | WP_108242490.1 | antitoxin | - |
P7I90_RS28190 (P7I90_28190) | 6053293..6053685 | + | 393 | WP_033996900.1 | hypothetical protein | - |
P7I90_RS28195 (P7I90_28195) | 6053800..6054093 | - | 294 | WP_033996897.1 | putative addiction module antidote protein | Antitoxin |
P7I90_RS28200 (P7I90_28200) | 6054094..6054384 | - | 291 | WP_033996895.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I90_RS28205 (P7I90_28205) | 6054695..6054895 | + | 201 | WP_033996893.1 | hypothetical protein | - |
P7I90_RS28210 (P7I90_28210) | 6054895..6055119 | + | 225 | WP_033996891.1 | hypothetical protein | - |
P7I90_RS28215 (P7I90_28215) | 6055128..6055670 | + | 543 | WP_161566247.1 | phage antirepressor N-terminal domain-containing protein | - |
P7I90_RS28220 (P7I90_28220) | 6055690..6055887 | + | 198 | WP_033996889.1 | hypothetical protein | - |
P7I90_RS28225 (P7I90_28225) | 6055966..6056175 | + | 210 | WP_033996886.1 | hypothetical protein | - |
P7I90_RS28230 (P7I90_28230) | 6056172..6057314 | + | 1143 | WP_033996883.1 | integrase | - |
P7I90_RS28235 (P7I90_28235) | 6057713..6058771 | + | 1059 | WP_003096179.1 | dTDP-glucose 4,6-dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 6020719..6058771 | 38052 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11001.67 Da Isoelectric Point: 6.3329
>T280926 WP_033996895.1 NZ_CP124641:c6054384-6054094 [Pseudomonas aeruginosa]
MYSIIETEAFSDWLNGLKDTVTRMRLIKRLQRASLGNLGDVKPVGEGVYEMREFFGPGWRMYYVQQGDVLLIMLGGGDKS
SQQRDIERAIQLSKEL
MYSIIETEAFSDWLNGLKDTVTRMRLIKRLQRASLGNLGDVKPVGEGVYEMREFFGPGWRMYYVQQGDVLLIMLGGGDKS
SQQRDIERAIQLSKEL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|