Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 6091075..6091659 | Replicon | chromosome |
Accession | NZ_CP124638 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01158 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P7I84_RS28480 | Protein ID | WP_033996895.1 |
Coordinates | 6091369..6091659 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P7I84_RS28475 | Protein ID | WP_033996897.1 |
Coordinates | 6091075..6091368 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I84_RS28445 (P7I84_28455) | 6086425..6086658 | + | 234 | WP_033996905.1 | hypothetical protein | - |
P7I84_RS28450 (P7I84_28460) | 6086678..6089395 | + | 2718 | WP_033996995.1 | toprim domain-containing protein | - |
P7I84_RS28455 (P7I84_28465) | 6089440..6089583 | + | 144 | WP_153576040.1 | hypothetical protein | - |
P7I84_RS28460 (P7I84_28470) | 6089634..6090209 | + | 576 | WP_052157654.1 | hypothetical protein | - |
P7I84_RS28465 (P7I84_28475) | 6090401..6090571 | + | 171 | WP_108242490.1 | antitoxin | - |
P7I84_RS28470 (P7I84_28480) | 6090568..6090960 | + | 393 | WP_033996900.1 | hypothetical protein | - |
P7I84_RS28475 (P7I84_28485) | 6091075..6091368 | - | 294 | WP_033996897.1 | putative addiction module antidote protein | Antitoxin |
P7I84_RS28480 (P7I84_28490) | 6091369..6091659 | - | 291 | WP_033996895.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I84_RS28485 (P7I84_28495) | 6091970..6092170 | + | 201 | WP_033996893.1 | hypothetical protein | - |
P7I84_RS28490 (P7I84_28500) | 6092170..6092394 | + | 225 | WP_033996891.1 | hypothetical protein | - |
P7I84_RS28495 (P7I84_28505) | 6092403..6092945 | + | 543 | WP_161566247.1 | phage antirepressor N-terminal domain-containing protein | - |
P7I84_RS28500 (P7I84_28510) | 6092965..6093162 | + | 198 | WP_033996889.1 | hypothetical protein | - |
P7I84_RS28505 (P7I84_28515) | 6093241..6093450 | + | 210 | WP_033996886.1 | hypothetical protein | - |
P7I84_RS28510 (P7I84_28520) | 6093447..6094589 | + | 1143 | WP_033996883.1 | integrase | - |
P7I84_RS28515 (P7I84_28525) | 6094988..6096046 | + | 1059 | WP_003096179.1 | dTDP-glucose 4,6-dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 6020779..6096046 | 75267 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11001.67 Da Isoelectric Point: 6.3329
>T280919 WP_033996895.1 NZ_CP124638:c6091659-6091369 [Pseudomonas aeruginosa]
MYSIIETEAFSDWLNGLKDTVTRMRLIKRLQRASLGNLGDVKPVGEGVYEMREFFGPGWRMYYVQQGDVLLIMLGGGDKS
SQQRDIERAIQLSKEL
MYSIIETEAFSDWLNGLKDTVTRMRLIKRLQRASLGNLGDVKPVGEGVYEMREFFGPGWRMYYVQQGDVLLIMLGGGDKS
SQQRDIERAIQLSKEL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|