Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4902344..4902952 | Replicon | chromosome |
Accession | NZ_CP124638 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01158 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A444LUU5 |
Locus tag | P7I84_RS22860 | Protein ID | WP_019486378.1 |
Coordinates | 4902344..4902691 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | P7I84_RS22865 | Protein ID | WP_003114155.1 |
Coordinates | 4902701..4902952 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I84_RS22830 (P7I84_22840) | 4897763..4897975 | + | 213 | WP_023112330.1 | cysteine-rich CWC family protein | - |
P7I84_RS22835 (P7I84_22845) | 4897975..4898667 | + | 693 | WP_022579823.1 | 16S rRNA pseudouridine(516) synthase | - |
P7I84_RS22840 (P7I84_22850) | 4898803..4899846 | + | 1044 | WP_003110811.1 | L,D-transpeptidase | - |
P7I84_RS22845 (P7I84_22855) | 4899926..4900663 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
P7I84_RS22850 (P7I84_22860) | 4901115..4902017 | + | 903 | WP_003085447.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
P7I84_RS22860 (P7I84_22870) | 4902344..4902691 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I84_RS22865 (P7I84_22875) | 4902701..4902952 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P7I84_RS22870 (P7I84_22880) | 4903166..4904149 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
P7I84_RS22875 (P7I84_22885) | 4904149..4905439 | - | 1291 | Protein_4526 | hypothetical protein | - |
P7I84_RS22880 (P7I84_22890) | 4905698..4906960 | - | 1263 | WP_003133724.1 | zonular occludens toxin domain-containing protein | - |
P7I84_RS22885 (P7I84_22895) | 4906962..4907312 | - | 351 | WP_003133726.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4902344..4919350 | 17006 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T280917 WP_019486378.1 NZ_CP124638:c4902691-4902344 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A444LUU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |