Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 49587..50173 | Replicon | plasmid unnamed1 |
Accession | NZ_CP124633 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01162 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | P7I87_RS35080 | Protein ID | WP_003120987.1 |
Coordinates | 49587..49886 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P7I87_RS35085 | Protein ID | WP_003448662.1 |
Coordinates | 49883..50173 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I87_RS35060 (P7I87_35060) | 44701..45234 | - | 534 | WP_023125174.1 | type IV pilus biogenesis protein PilP | - |
P7I87_RS35065 (P7I87_35065) | 45224..46549 | - | 1326 | WP_023125173.1 | type 4b pilus protein PilO2 | - |
P7I87_RS35070 (P7I87_35070) | 46553..48262 | - | 1710 | WP_023125172.1 | PilN family type IVB pilus formation outer membrane protein | - |
P7I87_RS35075 (P7I87_35075) | 48262..49385 | - | 1124 | Protein_55 | TcpQ domain-containing protein | - |
P7I87_RS35080 (P7I87_35080) | 49587..49886 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I87_RS35085 (P7I87_35085) | 49883..50173 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
P7I87_RS35090 (P7I87_35090) | 50256..50588 | - | 333 | WP_031640358.1 | hypothetical protein | - |
P7I87_RS35095 (P7I87_35095) | 50585..50719 | - | 135 | WP_033179080.1 | hypothetical protein | - |
P7I87_RS35100 (P7I87_35100) | 50729..52705 | - | 1977 | WP_023125171.1 | DEAD/DEAH box helicase | - |
P7I87_RS35105 (P7I87_35105) | 52702..54597 | - | 1896 | WP_031640357.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..82465 | 82465 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T280912 WP_003120987.1 NZ_CP124633:49587-49886 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|