Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 6147767..6148353 | Replicon | chromosome |
| Accession | NZ_CP124632 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01162 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | P7I87_RS29330 | Protein ID | WP_003120987.1 |
| Coordinates | 6148054..6148353 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | P7I87_RS29325 | Protein ID | WP_003448662.1 |
| Coordinates | 6147767..6148057 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I87_RS29305 (P7I87_29305) | 6143343..6145238 | + | 1896 | WP_031640357.1 | hypothetical protein | - |
| P7I87_RS29310 (P7I87_29310) | 6145235..6147211 | + | 1977 | WP_023125171.1 | DEAD/DEAH box helicase | - |
| P7I87_RS29315 (P7I87_29315) | 6147221..6147355 | + | 135 | WP_033179080.1 | hypothetical protein | - |
| P7I87_RS29320 (P7I87_29320) | 6147352..6147684 | + | 333 | WP_031640358.1 | hypothetical protein | - |
| P7I87_RS29325 (P7I87_29325) | 6147767..6148057 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| P7I87_RS29330 (P7I87_29330) | 6148054..6148353 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I87_RS29335 (P7I87_29335) | 6148555..6149678 | + | 1124 | Protein_5803 | TcpQ domain-containing protein | - |
| P7I87_RS29340 (P7I87_29340) | 6149678..6151387 | + | 1710 | WP_023125172.1 | PilN family type IVB pilus formation outer membrane protein | - |
| P7I87_RS29345 (P7I87_29345) | 6151391..6152716 | + | 1326 | WP_023125173.1 | type 4b pilus protein PilO2 | - |
| P7I87_RS29350 (P7I87_29350) | 6152706..6153239 | + | 534 | WP_023125174.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 6120242..6202738 | 82496 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T280910 WP_003120987.1 NZ_CP124632:c6148353-6148054 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|