Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 6028330..6028944 Replicon chromosome
Accession NZ_CP124632
Organism Pseudomonas aeruginosa strain 2021CK-01162

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag P7I87_RS28780 Protein ID WP_071534354.1
Coordinates 6028762..6028944 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag P7I87_RS28775 Protein ID WP_012077229.1
Coordinates 6028330..6028734 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7I87_RS28750 (P7I87_28750) 6024470..6025180 + 711 WP_012074129.1 hypothetical protein -
P7I87_RS28755 (P7I87_28755) 6025177..6026097 + 921 WP_012074128.1 hypothetical protein -
P7I87_RS28760 (P7I87_28760) 6026094..6026633 + 540 WP_012074127.1 hypothetical protein -
P7I87_RS28765 (P7I87_28765) 6026633..6027331 + 699 WP_033896049.1 hypothetical protein -
P7I87_RS28770 (P7I87_28770) 6027316..6028287 + 972 WP_012077228.1 hypothetical protein -
P7I87_RS28775 (P7I87_28775) 6028330..6028734 - 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
P7I87_RS28780 (P7I87_28780) 6028762..6028944 - 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
P7I87_RS28785 (P7I87_28785) 6029487..6030419 - 933 WP_078451856.1 ZIP family metal transporter -
P7I87_RS28790 (P7I87_28790) 6030438..6031049 - 612 WP_003098862.1 superoxide dismutase -
P7I87_RS28795 (P7I87_28795) 6031079..6031510 - 432 Protein_5696 hypothetical protein -
P7I87_RS28800 (P7I87_28800) 6031538..6032914 - 1377 WP_023096113.1 class II fumarate hydratase FumC -
P7I87_RS28805 (P7I87_28805) 6032907..6033302 - 396 WP_003094374.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5991455..6028944 37489


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T280909 WP_071534354.1 NZ_CP124632:c6028944-6028762 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT280909 WP_012077229.1 NZ_CP124632:c6028734-6028330 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References