Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 3905362..3905948 | Replicon | chromosome |
Accession | NZ_CP124632 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01162 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | P7I87_RS18495 | Protein ID | WP_003120987.1 |
Coordinates | 3905362..3905661 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P7I87_RS18500 | Protein ID | WP_003448662.1 |
Coordinates | 3905658..3905948 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I87_RS18475 (P7I87_18475) | 3900476..3901009 | - | 534 | WP_023125174.1 | type IV pilus biogenesis protein PilP | - |
P7I87_RS18480 (P7I87_18480) | 3900999..3902324 | - | 1326 | WP_023125173.1 | type 4b pilus protein PilO2 | - |
P7I87_RS18485 (P7I87_18485) | 3902328..3904037 | - | 1710 | WP_023125172.1 | PilN family type IVB pilus formation outer membrane protein | - |
P7I87_RS18490 (P7I87_18490) | 3904037..3905160 | - | 1124 | Protein_3655 | TcpQ domain-containing protein | - |
P7I87_RS18495 (P7I87_18495) | 3905362..3905661 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I87_RS18500 (P7I87_18500) | 3905658..3905948 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
P7I87_RS18505 (P7I87_18505) | 3906031..3906363 | - | 333 | WP_031640358.1 | hypothetical protein | - |
P7I87_RS18510 (P7I87_18510) | 3906360..3906494 | - | 135 | WP_033179080.1 | hypothetical protein | - |
P7I87_RS18515 (P7I87_18515) | 3906504..3908480 | - | 1977 | WP_023125171.1 | DEAD/DEAH box helicase | - |
P7I87_RS18520 (P7I87_18520) | 3908477..3910372 | - | 1896 | WP_031640357.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | blaIMP-18 / ant(3'')-Ia / sul1 | - | 3796954..4178213 | 381259 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T280906 WP_003120987.1 NZ_CP124632:3905362-3905661 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|