Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
| Location | 3004360..3004913 | Replicon | chromosome |
| Accession | NZ_CP124632 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01162 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q88JZ3 |
| Locus tag | P7I87_RS14460 | Protein ID | WP_010953434.1 |
| Coordinates | 3004620..3004913 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A431XAN4 |
| Locus tag | P7I87_RS14455 | Protein ID | WP_003155922.1 |
| Coordinates | 3004360..3004632 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I87_RS14450 (P7I87_14450) | 3003991..3004236 | + | 246 | WP_034065762.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| P7I87_RS14455 (P7I87_14455) | 3004360..3004632 | + | 273 | WP_003155922.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| P7I87_RS14460 (P7I87_14460) | 3004620..3004913 | + | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I87_RS14465 (P7I87_14465) | 3004907..3006316 | - | 1410 | WP_034065764.1 | site-specific integrase | - |
| P7I87_RS14470 (P7I87_14470) | 3006733..3007434 | - | 702 | WP_031640384.1 | hypothetical protein | - |
| P7I87_RS14475 (P7I87_14475) | 3007550..3007696 | + | 147 | Protein_2855 | DNA binding protein | - |
| P7I87_RS14480 (P7I87_14480) | 3007824..3009614 | - | 1791 | WP_023095445.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2971487..3013738 | 42251 | |
| - | inside | Genomic island | - | - | 2965014..3013738 | 48724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T280905 WP_010953434.1 NZ_CP124632:3004620-3004913 [Pseudomonas aeruginosa]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2W5CNE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A431XAN4 |