Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 478248..478753 Replicon chromosome
Accession NZ_CP124632
Organism Pseudomonas aeruginosa strain 2021CK-01162

Toxin (Protein)


Gene name parE Uniprot ID V6A7K8
Locus tag P7I87_RS02250 Protein ID WP_003083773.1
Coordinates 478248..478529 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A1C7BDS9
Locus tag P7I87_RS02255 Protein ID WP_003083775.1
Coordinates 478526..478753 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7I87_RS02225 (P7I87_02225) 473499..474848 + 1350 WP_003137006.1 C4-dicarboxylate transporter DctA -
P7I87_RS02230 (P7I87_02230) 474897..475583 + 687 WP_003083762.1 FadR/GntR family transcriptional regulator -
P7I87_RS02235 (P7I87_02235) 475684..476418 + 735 WP_003083764.1 GntR family transcriptional regulator -
P7I87_RS02240 (P7I87_02240) 476598..477008 + 411 WP_003110659.1 aegerolysin family protein -
P7I87_RS02245 (P7I87_02245) 477040..477948 - 909 WP_003083769.1 LysR family transcriptional regulator -
P7I87_RS02250 (P7I87_02250) 478248..478529 - 282 WP_003083773.1 type II toxin-antitoxin system toxin ParE Toxin
P7I87_RS02255 (P7I87_02255) 478526..478753 - 228 WP_003083775.1 CopG family ribbon-helix-helix protein Antitoxin
P7I87_RS02260 (P7I87_02260) 478929..479549 - 621 WP_003101226.1 hypothetical protein -
P7I87_RS02265 (P7I87_02265) 479650..480150 + 501 WP_003083778.1 LEA type 2 family protein -
P7I87_RS02270 (P7I87_02270) 480223..480564 + 342 WP_014603467.1 zinc ribbon domain-containing protein YjdM -
P7I87_RS02275 (P7I87_02275) 480648..482075 - 1428 WP_003083784.1 GABA permease -
P7I87_RS02280 (P7I87_02280) 482243..483736 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element floR / tet(G) / sul1 / ant(3'')-Ia / blaOXA-2 / blaGES-20 / blaGES-19 exoT / phzH / tagQ / tagR / tagS / tagT / ppkA / pppA / tagF/pppB / icmF1/tssM1 / dotU1 / hsiJ1 / lip1 / fha1 / hsiA1 / hsiB1/vipA / hsiC1/vipB / hcp1 / hsiE1 / hsiF1 / hsiG1 / hsiH1 / clpV1 / vgrG1a / vgrG1b / cheW 189678..576942 387264


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10462.19 Da        Isoelectric Point: 10.0435

>T280902 WP_003083773.1 NZ_CP124632:c478529-478248 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8556.58 Da        Isoelectric Point: 5.5740

>AT280902 WP_003083775.1 NZ_CP124632:c478753-478526 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHTEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
PDB 6XRW

Antitoxin

Source ID Structure
AlphaFold DB A0A1C7BDS9

References