Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 478248..478753 | Replicon | chromosome |
| Accession | NZ_CP124632 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01162 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | P7I87_RS02250 | Protein ID | WP_003083773.1 |
| Coordinates | 478248..478529 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | P7I87_RS02255 | Protein ID | WP_003083775.1 |
| Coordinates | 478526..478753 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I87_RS02225 (P7I87_02225) | 473499..474848 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
| P7I87_RS02230 (P7I87_02230) | 474897..475583 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| P7I87_RS02235 (P7I87_02235) | 475684..476418 | + | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
| P7I87_RS02240 (P7I87_02240) | 476598..477008 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
| P7I87_RS02245 (P7I87_02245) | 477040..477948 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| P7I87_RS02250 (P7I87_02250) | 478248..478529 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| P7I87_RS02255 (P7I87_02255) | 478526..478753 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| P7I87_RS02260 (P7I87_02260) | 478929..479549 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| P7I87_RS02265 (P7I87_02265) | 479650..480150 | + | 501 | WP_003083778.1 | LEA type 2 family protein | - |
| P7I87_RS02270 (P7I87_02270) | 480223..480564 | + | 342 | WP_014603467.1 | zinc ribbon domain-containing protein YjdM | - |
| P7I87_RS02275 (P7I87_02275) | 480648..482075 | - | 1428 | WP_003083784.1 | GABA permease | - |
| P7I87_RS02280 (P7I87_02280) | 482243..483736 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | floR / tet(G) / sul1 / ant(3'')-Ia / blaOXA-2 / blaGES-20 / blaGES-19 | exoT / phzH / tagQ / tagR / tagS / tagT / ppkA / pppA / tagF/pppB / icmF1/tssM1 / dotU1 / hsiJ1 / lip1 / fha1 / hsiA1 / hsiB1/vipA / hsiC1/vipB / hcp1 / hsiE1 / hsiF1 / hsiG1 / hsiH1 / clpV1 / vgrG1a / vgrG1b / cheW | 189678..576942 | 387264 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T280902 WP_003083773.1 NZ_CP124632:c478529-478248 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|