Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
Location | 5537337..5537890 | Replicon | chromosome |
Accession | NZ_CP124626 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01161 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q88JZ3 |
Locus tag | P7I86_RS26180 | Protein ID | WP_010953434.1 |
Coordinates | 5537337..5537630 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A431XAN4 |
Locus tag | P7I86_RS26185 | Protein ID | WP_003155922.1 |
Coordinates | 5537618..5537890 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I86_RS26160 (P7I86_26160) | 5532636..5534426 | + | 1791 | WP_023095445.1 | AAA family ATPase | - |
P7I86_RS26165 (P7I86_26165) | 5534554..5534700 | - | 147 | Protein_5168 | DNA binding protein | - |
P7I86_RS26170 (P7I86_26170) | 5534816..5535517 | + | 702 | WP_031640384.1 | hypothetical protein | - |
P7I86_RS26175 (P7I86_26175) | 5535934..5537343 | + | 1410 | WP_034065764.1 | site-specific integrase | - |
P7I86_RS26180 (P7I86_26180) | 5537337..5537630 | - | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I86_RS26185 (P7I86_26185) | 5537618..5537890 | - | 273 | WP_003155922.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P7I86_RS26190 (P7I86_26190) | 5538014..5538259 | - | 246 | WP_034065762.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5528721..5572214 | 43493 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T280899 WP_010953434.1 NZ_CP124626:c5537630-5537337 [Pseudomonas aeruginosa]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W5CNE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A431XAN4 |