Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2539562..2540176 Replicon chromosome
Accession NZ_CP124626
Organism Pseudomonas aeruginosa strain 2021CK-01161

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag P7I86_RS11945 Protein ID WP_071534354.1
Coordinates 2539562..2539744 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag P7I86_RS11950 Protein ID WP_012077229.1
Coordinates 2539772..2540176 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7I86_RS11920 (P7I86_11920) 2535204..2535599 + 396 WP_003094374.1 hypothetical protein -
P7I86_RS11925 (P7I86_11925) 2535592..2536968 + 1377 WP_023096113.1 class II fumarate hydratase FumC -
P7I86_RS11930 (P7I86_11930) 2536996..2537427 + 432 Protein_2348 hypothetical protein -
P7I86_RS11935 (P7I86_11935) 2537457..2538068 + 612 WP_003098862.1 superoxide dismutase -
P7I86_RS11940 (P7I86_11940) 2538087..2539019 + 933 WP_078451856.1 ZIP family metal transporter -
P7I86_RS11945 (P7I86_11945) 2539562..2539744 + 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
P7I86_RS11950 (P7I86_11950) 2539772..2540176 + 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
P7I86_RS11955 (P7I86_11955) 2540219..2541190 - 972 WP_012077228.1 hypothetical protein -
P7I86_RS11960 (P7I86_11960) 2541175..2541873 - 699 WP_033896049.1 hypothetical protein -
P7I86_RS11965 (P7I86_11965) 2541873..2542412 - 540 WP_012074127.1 hypothetical protein -
P7I86_RS11970 (P7I86_11970) 2542409..2543329 - 921 WP_012074128.1 hypothetical protein -
P7I86_RS11975 (P7I86_11975) 2543326..2544036 - 711 WP_012074129.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2539562..2577050 37488


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T280896 WP_071534354.1 NZ_CP124626:2539562-2539744 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT280896 WP_012077229.1 NZ_CP124626:2539772-2540176 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References