Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 2420154..2420740 | Replicon | chromosome |
Accession | NZ_CP124626 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01161 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | P7I86_RS11400 | Protein ID | WP_003120987.1 |
Coordinates | 2420154..2420453 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P7I86_RS11405 | Protein ID | WP_003448662.1 |
Coordinates | 2420450..2420740 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I86_RS11380 (P7I86_11380) | 2415268..2415801 | - | 534 | WP_023125174.1 | type IV pilus biogenesis protein PilP | - |
P7I86_RS11385 (P7I86_11385) | 2415791..2417116 | - | 1326 | WP_023125173.1 | type 4b pilus protein PilO2 | - |
P7I86_RS11390 (P7I86_11390) | 2417120..2418829 | - | 1710 | WP_023125172.1 | PilN family type IVB pilus formation outer membrane protein | - |
P7I86_RS11395 (P7I86_11395) | 2418829..2419952 | - | 1124 | Protein_2242 | TcpQ domain-containing protein | - |
P7I86_RS11400 (P7I86_11400) | 2420154..2420453 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I86_RS11405 (P7I86_11405) | 2420450..2420740 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
P7I86_RS11410 (P7I86_11410) | 2420823..2421155 | - | 333 | WP_031640358.1 | hypothetical protein | - |
P7I86_RS11415 (P7I86_11415) | 2421152..2421286 | - | 135 | WP_033179080.1 | hypothetical protein | - |
P7I86_RS11420 (P7I86_11420) | 2421296..2423272 | - | 1977 | WP_023125171.1 | DEAD/DEAH box helicase | - |
P7I86_RS11425 (P7I86_11425) | 2423269..2425164 | - | 1896 | WP_031640357.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2365769..2448265 | 82496 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T280895 WP_003120987.1 NZ_CP124626:2420154-2420453 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|