Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 799198..799703 | Replicon | chromosome |
| Accession | NZ_CP124626 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01161 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | P7I86_RS03710 | Protein ID | WP_003083773.1 |
| Coordinates | 799422..799703 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | P7I86_RS03705 | Protein ID | WP_003083775.1 |
| Coordinates | 799198..799425 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I86_RS03680 (P7I86_03680) | 794215..795708 | + | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| P7I86_RS03685 (P7I86_03685) | 795876..797303 | + | 1428 | WP_003083784.1 | GABA permease | - |
| P7I86_RS03690 (P7I86_03690) | 797387..797728 | - | 342 | WP_014603467.1 | zinc ribbon domain-containing protein YjdM | - |
| P7I86_RS03695 (P7I86_03695) | 797801..798301 | - | 501 | WP_003083778.1 | LEA type 2 family protein | - |
| P7I86_RS03700 (P7I86_03700) | 798402..799022 | + | 621 | WP_003101226.1 | hypothetical protein | - |
| P7I86_RS03705 (P7I86_03705) | 799198..799425 | + | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| P7I86_RS03710 (P7I86_03710) | 799422..799703 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| P7I86_RS03715 (P7I86_03715) | 800003..800911 | + | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| P7I86_RS03720 (P7I86_03720) | 800943..801353 | - | 411 | WP_003110659.1 | aegerolysin family protein | - |
| P7I86_RS03725 (P7I86_03725) | 801533..802267 | - | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
| P7I86_RS03730 (P7I86_03730) | 802368..803054 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| P7I86_RS03735 (P7I86_03735) | 803103..804452 | - | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | blaGES-19 / blaGES-20 / blaOXA-2 / sul1 / tet(G) / floR | cheW / vgrG1b / vgrG1a / clpV1 / hsiH1 / hsiG1 / hsiF1 / hsiE1 / hcp1 / hsiC1/vipB / hsiB1/vipA / hsiA1 / fha1 / lip1 / hsiJ1 / dotU1 / icmF1/tssM1 / tagF/pppB / pppA / ppkA / tagT / tagS / tagR / tagQ / phzH / exoT | 734753..1093141 | 358388 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T280893 WP_003083773.1 NZ_CP124626:799422-799703 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|