Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 6054164..6054748 | Replicon | chromosome |
| Accession | NZ_CP124624 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01157 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P7I83_RS28200 | Protein ID | WP_033996895.1 |
| Coordinates | 6054458..6054748 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | P7I83_RS28195 | Protein ID | WP_033996897.1 |
| Coordinates | 6054164..6054457 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I83_RS28165 (P7I83_28165) | 6049514..6049747 | + | 234 | WP_033996905.1 | hypothetical protein | - |
| P7I83_RS28170 (P7I83_28170) | 6049767..6052484 | + | 2718 | WP_033996995.1 | toprim domain-containing protein | - |
| P7I83_RS28175 (P7I83_28175) | 6052529..6052672 | + | 144 | WP_153576040.1 | hypothetical protein | - |
| P7I83_RS28180 (P7I83_28180) | 6052723..6053298 | + | 576 | WP_052157654.1 | hypothetical protein | - |
| P7I83_RS28185 (P7I83_28185) | 6053490..6053660 | + | 171 | WP_108242490.1 | antitoxin | - |
| P7I83_RS28190 (P7I83_28190) | 6053657..6054049 | + | 393 | WP_033996900.1 | hypothetical protein | - |
| P7I83_RS28195 (P7I83_28195) | 6054164..6054457 | - | 294 | WP_033996897.1 | putative addiction module antidote protein | Antitoxin |
| P7I83_RS28200 (P7I83_28200) | 6054458..6054748 | - | 291 | WP_033996895.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I83_RS28205 (P7I83_28205) | 6055059..6055259 | + | 201 | WP_033996893.1 | hypothetical protein | - |
| P7I83_RS28210 (P7I83_28210) | 6055259..6055483 | + | 225 | WP_033996891.1 | hypothetical protein | - |
| P7I83_RS28215 (P7I83_28215) | 6055492..6056034 | + | 543 | WP_161566247.1 | phage antirepressor N-terminal domain-containing protein | - |
| P7I83_RS28220 (P7I83_28220) | 6056054..6056251 | + | 198 | WP_033996889.1 | hypothetical protein | - |
| P7I83_RS28225 (P7I83_28225) | 6056330..6056539 | + | 210 | WP_033996886.1 | hypothetical protein | - |
| P7I83_RS28230 (P7I83_28230) | 6056536..6057678 | + | 1143 | WP_033996883.1 | integrase | - |
| P7I83_RS28235 (P7I83_28235) | 6058077..6059135 | + | 1059 | WP_003096179.1 | dTDP-glucose 4,6-dehydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 6020756..6059135 | 38379 | |
| - | inside | Prophage | - | - | 6018125..6059135 | 41010 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11001.67 Da Isoelectric Point: 6.3329
>T280892 WP_033996895.1 NZ_CP124624:c6054748-6054458 [Pseudomonas aeruginosa]
MYSIIETEAFSDWLNGLKDTVTRMRLIKRLQRASLGNLGDVKPVGEGVYEMREFFGPGWRMYYVQQGDVLLIMLGGGDKS
SQQRDIERAIQLSKEL
MYSIIETEAFSDWLNGLKDTVTRMRLIKRLQRASLGNLGDVKPVGEGVYEMREFFGPGWRMYYVQQGDVLLIMLGGGDKS
SQQRDIERAIQLSKEL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|