Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4982057..4982665 | Replicon | chromosome |
Accession | NZ_CP124622 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01159 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | P7I85_RS23290 | Protein ID | WP_003114156.1 |
Coordinates | 4982057..4982404 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A643EG04 |
Locus tag | P7I85_RS23295 | Protein ID | WP_042857565.1 |
Coordinates | 4982414..4982665 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I85_RS23260 (P7I85_23260) | 4977477..4977689 | + | 213 | WP_275988278.1 | cysteine-rich CWC family protein | - |
P7I85_RS23265 (P7I85_23265) | 4977689..4978381 | + | 693 | WP_023104853.1 | 16S rRNA pseudouridine(516) synthase | - |
P7I85_RS23270 (P7I85_23270) | 4978517..4979560 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
P7I85_RS23275 (P7I85_23275) | 4979640..4980377 | + | 738 | WP_172773749.1 | murein L,D-transpeptidase catalytic domain family protein | - |
P7I85_RS23280 (P7I85_23280) | 4980829..4981731 | + | 903 | WP_003123042.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
P7I85_RS23290 (P7I85_23290) | 4982057..4982404 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I85_RS23295 (P7I85_23295) | 4982414..4982665 | - | 252 | WP_042857565.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P7I85_RS23300 (P7I85_23300) | 4982879..4983862 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
P7I85_RS23305 (P7I85_23305) | 4983862..4985154 | - | 1293 | WP_003454977.1 | hypothetical protein | - |
P7I85_RS23310 (P7I85_23310) | 4985413..4986675 | - | 1263 | WP_282414015.1 | zonular occludens toxin domain-containing protein | - |
P7I85_RS23315 (P7I85_23315) | 4986677..4987027 | - | 351 | WP_003159569.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 4982057..5002582 | 20525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T280884 WP_003114156.1 NZ_CP124622:c4982404-4982057 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A643EG04 |