Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 567560..568323 | Replicon | chromosome |
| Accession | NZ_CP124614 | ||
| Organism | Vibrio sp. YMD68 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A919BFZ0 |
| Locus tag | QF117_RS08645 | Protein ID | WP_023584043.1 |
| Coordinates | 567560..568066 (-) | Length | 169 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | QF117_RS08650 | Protein ID | WP_000212004.1 |
| Coordinates | 568057..568323 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QF117_RS08615 (QF117_08615) | 563413..563694 | + | 282 | WP_000433891.1 | type IV conjugative transfer system protein TraL | - |
| QF117_RS08620 (QF117_08620) | 563691..564317 | + | 627 | WP_000667170.1 | TraE/TraK family type IV conjugative transfer system protein | - |
| QF117_RS08625 (QF117_08625) | 564301..565197 | + | 897 | WP_269123861.1 | type-F conjugative transfer system secretin TraK | - |
| QF117_RS08630 (QF117_08630) | 565200..566489 | + | 1290 | WP_169650375.1 | TraB/VirB10 family protein | - |
| QF117_RS08635 (QF117_08635) | 566564..567136 | + | 573 | WP_001944091.1 | type IV conjugative transfer system lipoprotein TraV | - |
| QF117_RS08640 (QF117_08640) | 567133..567519 | + | 387 | WP_023584042.1 | TraA family conjugative transfer protein | - |
| QF117_RS08645 (QF117_08645) | 567560..568066 | - | 507 | WP_023584043.1 | GNAT family N-acetyltransferase | Toxin |
| QF117_RS08650 (QF117_08650) | 568057..568323 | - | 267 | WP_000212004.1 | DUF1778 domain-containing protein | Antitoxin |
| QF117_RS08655 (QF117_08655) | 568692..569384 | + | 693 | WP_001228924.1 | DsbC family protein | - |
| QF117_RS08660 (QF117_08660) | 569384..571783 | + | 2400 | WP_024008831.1 | type IV secretion system protein TraC | - |
| QF117_RS08665 (QF117_08665) | 571776..572123 | + | 348 | WP_004249366.1 | hypothetical protein | - |
| QF117_RS08670 (QF117_08670) | 572107..572619 | + | 513 | WP_172665238.1 | S26 family signal peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 18278.00 Da Isoelectric Point: 7.2132
>T280876 WP_023584043.1 NZ_CP124614:c568066-567560 [Vibrio sp. YMD68]
MGISAPTLLTDEHQLNAFQCGIEELDTWLRKQALKSQKRGTARVYVVNDTDAHQVVGYYAIAMGSVSREQAFSSLRRNSP
DPIPMVILARLGVDNAYQGQGIAAGLLKDCIIRSVQAMNAVGGAGILVHAIDGSAQTFYKKFGFKESTFDPLVLMARICD
IEKSLSID
MGISAPTLLTDEHQLNAFQCGIEELDTWLRKQALKSQKRGTARVYVVNDTDAHQVVGYYAIAMGSVSREQAFSSLRRNSP
DPIPMVILARLGVDNAYQGQGIAAGLLKDCIIRSVQAMNAVGGAGILVHAIDGSAQTFYKKFGFKESTFDPLVLMARICD
IEKSLSID
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|