Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-YefM |
Location | 947254..947799 | Replicon | chromosome |
Accession | NZ_CP124613 | ||
Organism | Vibrio sp. YMD68 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QF117_RS04275 | Protein ID | WP_282384864.1 |
Coordinates | 947254..947550 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A4U2ER13 |
Locus tag | QF117_RS04280 | Protein ID | WP_045957228.1 |
Coordinates | 947557..947799 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QF117_RS04250 (QF117_04250) | 942464..942556 | + | 93 | WP_005445235.1 | DUF3265 domain-containing protein | - |
QF117_RS04255 (QF117_04255) | 942590..942910 | + | 321 | WP_282384861.1 | hypothetical protein | - |
QF117_RS04260 (QF117_04260) | 942900..943391 | + | 492 | WP_108162637.1 | hypothetical protein | - |
QF117_RS04265 (QF117_04265) | 945912..946202 | - | 291 | WP_282384863.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QF117_RS04270 (QF117_04270) | 946192..946440 | - | 249 | WP_005377003.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QF117_RS04275 (QF117_04275) | 947254..947550 | - | 297 | WP_282384864.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QF117_RS04280 (QF117_04280) | 947557..947799 | - | 243 | WP_045957228.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QF117_RS04285 (QF117_04285) | 948081..948587 | + | 507 | WP_282384803.1 | hypothetical protein | - |
QF117_RS04290 (QF117_04290) | 948610..948702 | + | 93 | WP_079764003.1 | DUF3265 domain-containing protein | - |
QF117_RS04295 (QF117_04295) | 948714..950303 | + | 1590 | WP_282384871.1 | RNA-directed DNA polymerase | - |
QF117_RS04300 (QF117_04300) | 950260..951372 | + | 1113 | WP_282384872.1 | DUF2971 domain-containing protein | - |
QF117_RS04305 (QF117_04305) | 952386..952694 | + | 309 | WP_005464425.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | - | 894306..961154 | 66848 | |
- | inside | Genomic island | - | - | 928286..952694 | 24408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11260.96 Da Isoelectric Point: 9.6269
>T280874 WP_282384864.1 NZ_CP124613:c947550-947254 [Vibrio sp. YMD68]
MQKNKYKLSKLAQAHLRKIKSYTVNNFSEMQWNNYKDTLLTGFQMLADNPAVGRSCDEIYPSGFYFPVGKHTAYFTKEDG
FILVVAVLGQLQLPQNHL
MQKNKYKLSKLAQAHLRKIKSYTVNNFSEMQWNNYKDTLLTGFQMLADNPAVGRSCDEIYPSGFYFPVGKHTAYFTKEDG
FILVVAVLGQLQLPQNHL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|