Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 947254..947799 Replicon chromosome
Accession NZ_CP124613
Organism Vibrio sp. YMD68

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag QF117_RS04275 Protein ID WP_282384864.1
Coordinates 947254..947550 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A4U2ER13
Locus tag QF117_RS04280 Protein ID WP_045957228.1
Coordinates 947557..947799 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QF117_RS04250 (QF117_04250) 942464..942556 + 93 WP_005445235.1 DUF3265 domain-containing protein -
QF117_RS04255 (QF117_04255) 942590..942910 + 321 WP_282384861.1 hypothetical protein -
QF117_RS04260 (QF117_04260) 942900..943391 + 492 WP_108162637.1 hypothetical protein -
QF117_RS04265 (QF117_04265) 945912..946202 - 291 WP_282384863.1 type II toxin-antitoxin system RelE/ParE family toxin -
QF117_RS04270 (QF117_04270) 946192..946440 - 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QF117_RS04275 (QF117_04275) 947254..947550 - 297 WP_282384864.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QF117_RS04280 (QF117_04280) 947557..947799 - 243 WP_045957228.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QF117_RS04285 (QF117_04285) 948081..948587 + 507 WP_282384803.1 hypothetical protein -
QF117_RS04290 (QF117_04290) 948610..948702 + 93 WP_079764003.1 DUF3265 domain-containing protein -
QF117_RS04295 (QF117_04295) 948714..950303 + 1590 WP_282384871.1 RNA-directed DNA polymerase -
QF117_RS04300 (QF117_04300) 950260..951372 + 1113 WP_282384872.1 DUF2971 domain-containing protein -
QF117_RS04305 (QF117_04305) 952386..952694 + 309 WP_005464425.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron - - 894306..961154 66848
- inside Genomic island - - 928286..952694 24408


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-92)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-63)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11260.96 Da        Isoelectric Point: 9.6269

>T280874 WP_282384864.1 NZ_CP124613:c947550-947254 [Vibrio sp. YMD68]
MQKNKYKLSKLAQAHLRKIKSYTVNNFSEMQWNNYKDTLLTGFQMLADNPAVGRSCDEIYPSGFYFPVGKHTAYFTKEDG
FILVVAVLGQLQLPQNHL

Download         Length: 297 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8947.14 Da        Isoelectric Point: 4.7914

>AT280874 WP_045957228.1 NZ_CP124613:c947799-947557 [Vibrio sp. YMD68]
MHTLTANDAKRNFGELLLSAQREPVKISKNSKDAVVVMSIKDYEELEAMKTDYLKHCFESAKQDLAQGNVVDGEDFLSAL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4U2ER13

References