Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 917478..918016 | Replicon | chromosome |
| Accession | NZ_CP124613 | ||
| Organism | Vibrio sp. YMD68 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QF117_RS04110 | Protein ID | WP_170908050.1 |
| Coordinates | 917478..917777 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | QF117_RS04115 | Protein ID | WP_282384828.1 |
| Coordinates | 917774..918016 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QF117_RS04090 (QF117_04090) | 913643..914539 | + | 897 | WP_282384822.1 | hypothetical protein | - |
| QF117_RS04095 (QF117_04095) | 914662..914970 | + | 309 | WP_282384824.1 | DUF2834 domain-containing protein | - |
| QF117_RS04100 (QF117_04100) | 915439..915981 | + | 543 | WP_282384826.1 | DinB family protein | - |
| QF117_RS04105 (QF117_04105) | 917001..917366 | + | 366 | WP_282384827.1 | hypothetical protein | - |
| QF117_RS04110 (QF117_04110) | 917478..917777 | - | 300 | WP_170908050.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QF117_RS04115 (QF117_04115) | 917774..918016 | - | 243 | WP_282384828.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| QF117_RS04120 (QF117_04120) | 919309..919842 | + | 534 | WP_282384830.1 | J domain-containing protein | - |
| QF117_RS04125 (QF117_04125) | 920483..920821 | + | 339 | WP_282384832.1 | DUF6404 family protein | - |
| QF117_RS04130 (QF117_04130) | 921294..921890 | + | 597 | WP_282384833.1 | class I SAM-dependent methyltransferase | - |
| QF117_RS04135 (QF117_04135) | 922024..922365 | + | 342 | WP_213867509.1 | SH3 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integron | - | - | 894306..961154 | 66848 | |
| - | inside | Genomic island | - | - | 892770..912997 | 20227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11691.38 Da Isoelectric Point: 9.9225
>T280872 WP_170908050.1 NZ_CP124613:c917777-917478 [Vibrio sp. YMD68]
MKPFQLTNKAKTDLRDIALFTSRRWGREQRNIYLKQFDDSFWLLAENPDIGKTCDEIRDGYRKFPQGSHVIFYRQVGSQN
IEVIRILHKSMDVNPIFGA
MKPFQLTNKAKTDLRDIALFTSRRWGREQRNIYLKQFDDSFWLLAENPDIGKTCDEIRDGYRKFPQGSHVIFYRQVGSQN
IEVIRILHKSMDVNPIFGA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|