Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-YefM |
Location | 895538..896087 | Replicon | chromosome |
Accession | NZ_CP124613 | ||
Organism | Vibrio sp. YMD68 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QF117_RS04000 | Protein ID | WP_282384797.1 |
Coordinates | 895538..895837 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | QF117_RS04005 | Protein ID | WP_282384798.1 |
Coordinates | 895845..896087 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QF117_RS03985 (QF117_03985) | 891484..892623 | - | 1140 | WP_282384794.1 | hypothetical protein | - |
QF117_RS03990 (QF117_03990) | 892770..894059 | - | 1290 | WP_282384795.1 | hypothetical protein | - |
QF117_RS03995 (QF117_03995) | 894306..895271 | - | 966 | WP_282386147.1 | integron integrase | - |
QF117_RS04000 (QF117_04000) | 895538..895837 | - | 300 | WP_282384797.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QF117_RS04005 (QF117_04005) | 895845..896087 | - | 243 | WP_282384798.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QF117_RS04010 (QF117_04010) | 897377..897703 | + | 327 | WP_282384799.1 | hypothetical protein | - |
QF117_RS04015 (QF117_04015) | 898727..899215 | + | 489 | WP_282384801.1 | hypothetical protein | - |
QF117_RS04020 (QF117_04020) | 899764..900270 | + | 507 | WP_282384803.1 | hypothetical protein | - |
QF117_RS04025 (QF117_04025) | 900293..900385 | + | 93 | WP_079764003.1 | DUF3265 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | - | 894306..961154 | 66848 | |
- | inside | Genomic island | - | - | 892770..912997 | 20227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11421.10 Da Isoelectric Point: 9.3362
>T280871 WP_282384797.1 NZ_CP124613:c895837-895538 [Vibrio sp. YMD68]
MHQSKYKLSKLAQTHLHKIKNYTVINFSEMQWNAYKDTLITGFQMLADNPSVGRSCNDLYENGVYFPIGKHTAYFTKEDG
FILIVAILGQSQLPQNHLR
MHQSKYKLSKLAQTHLHKIKNYTVINFSEMQWNAYKDTLITGFQMLADNPSVGRSCNDLYENGVYFPIGKHTAYFTKEDG
FILIVAILGQSQLPQNHLR
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|