Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 516930..517566 | Replicon | chromosome |
Accession | NZ_CP124601 | ||
Organism | Bacillus stercoris strain BS21 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QI003_RS02610 | Protein ID | WP_003156187.1 |
Coordinates | 517216..517566 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QI003_RS02605 | Protein ID | WP_003225183.1 |
Coordinates | 516930..517211 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI003_RS02585 (QI003_02585) | 513290..513889 | - | 600 | WP_040084115.1 | rhomboid family intramembrane serine protease | - |
QI003_RS02590 (QI003_02590) | 513983..514348 | + | 366 | WP_069839917.1 | holo-ACP synthase | - |
QI003_RS02595 (QI003_02595) | 514514..515530 | + | 1017 | WP_080478309.1 | outer membrane lipoprotein carrier protein LolA | - |
QI003_RS02600 (QI003_02600) | 515645..516814 | + | 1170 | WP_014662852.1 | alanine racemase | - |
QI003_RS02605 (QI003_02605) | 516930..517211 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QI003_RS02610 (QI003_02610) | 517216..517566 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QI003_RS02615 (QI003_02615) | 517681..518505 | + | 825 | WP_014662853.1 | RsbT co-antagonist protein RsbRA | - |
QI003_RS02620 (QI003_02620) | 518510..518875 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QI003_RS02625 (QI003_02625) | 518879..519280 | + | 402 | WP_003240352.1 | serine/threonine-protein kinase RsbT | - |
QI003_RS02630 (QI003_02630) | 519292..520299 | + | 1008 | WP_095432087.1 | phosphoserine phosphatase RsbU | - |
QI003_RS02635 (QI003_02635) | 520361..520690 | + | 330 | WP_014662855.1 | anti-sigma factor antagonist RsbV | - |
QI003_RS02640 (QI003_02640) | 520687..521169 | + | 483 | WP_014662856.1 | anti-sigma B factor RsbW | - |
QI003_RS02645 (QI003_02645) | 521135..521923 | + | 789 | WP_014662857.1 | RNA polymerase sigma factor SigB | - |
QI003_RS02650 (QI003_02650) | 521923..522522 | + | 600 | WP_014662858.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T280869 WP_003156187.1 NZ_CP124601:517216-517566 [Bacillus stercoris]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|