Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 5621931..5622517 | Replicon | chromosome |
| Accession | NZ_CP124600 | ||
| Organism | Pseudomonas aeruginosa strain Li010 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | QIU11_RS26675 | Protein ID | WP_003120987.1 |
| Coordinates | 5622218..5622517 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | QIU11_RS26670 | Protein ID | WP_003448662.1 |
| Coordinates | 5621931..5622221 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QIU11_RS26650 (QIU11_26650) | 5617082..5617291 | + | 210 | WP_003105733.1 | cold-shock protein | - |
| QIU11_RS26655 (QIU11_26655) | 5617513..5619402 | + | 1890 | WP_016851610.1 | hypothetical protein | - |
| QIU11_RS26660 (QIU11_26660) | 5619399..5621375 | + | 1977 | WP_058177552.1 | DEAD/DEAH box helicase | - |
| QIU11_RS26665 (QIU11_26665) | 5621516..5621860 | + | 345 | WP_016851612.1 | hypothetical protein | - |
| QIU11_RS26670 (QIU11_26670) | 5621931..5622221 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| QIU11_RS26675 (QIU11_26675) | 5622218..5622517 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QIU11_RS26680 (QIU11_26680) | 5622719..5623843 | + | 1125 | WP_058177553.1 | TcpQ domain-containing protein | - |
| QIU11_RS26685 (QIU11_26685) | 5623843..5625552 | + | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
| QIU11_RS26690 (QIU11_26690) | 5625556..5626881 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
| QIU11_RS26695 (QIU11_26695) | 5626871..5627404 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5595464..5691034 | 95570 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T280867 WP_003120987.1 NZ_CP124600:c5622517-5622218 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|