Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 2898584..2899191 | Replicon | chromosome |
Accession | NZ_CP124576 | ||
Organism | Sphingobium sp. AP49 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2LDW5 |
Locus tag | PMI04_RS13795 | Protein ID | WP_007706215.1 |
Coordinates | 2898584..2898889 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | J2WTW9 |
Locus tag | PMI04_RS13800 | Protein ID | WP_007706214.1 |
Coordinates | 2898886..2899191 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMI04_RS13770 (PMI04_013770) | 2893616..2894230 | - | 615 | WP_007706227.1 | hypothetical protein | - |
PMI04_RS13775 (PMI04_013775) | 2894386..2894643 | + | 258 | WP_007706222.1 | hypothetical protein | - |
PMI04_RS13780 (PMI04_013780) | 2895059..2896159 | + | 1101 | WP_007706220.1 | DUF262 domain-containing protein | - |
PMI04_RS13785 (PMI04_013785) | 2896156..2897277 | + | 1122 | WP_007706217.1 | DUF3696 domain-containing protein | - |
PMI04_RS13790 (PMI04_013790) | 2897323..2898189 | + | 867 | WP_157178078.1 | hypothetical protein | - |
PMI04_RS13795 (PMI04_013795) | 2898584..2898889 | - | 306 | WP_007706215.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
PMI04_RS13800 (PMI04_013800) | 2898886..2899191 | - | 306 | WP_007706214.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PMI04_RS13805 (PMI04_013805) | 2899740..2899955 | + | 216 | WP_081490990.1 | AlpA family phage regulatory protein | - |
PMI04_RS13810 (PMI04_013810) | 2899952..2900146 | + | 195 | WP_007706212.1 | helix-turn-helix domain-containing protein | - |
PMI04_RS13815 (PMI04_013815) | 2900121..2901335 | - | 1215 | WP_037485537.1 | site-specific integrase | - |
PMI04_RS13820 (PMI04_013820) | 2901843..2902673 | + | 831 | WP_007706204.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2880635..2901553 | 20918 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11442.99 Da Isoelectric Point: 5.6211
>T280858 WP_007706215.1 NZ_CP124576:c2898889-2898584 [Sphingobium sp. AP49]
MKLAWSNRATTDRLAIFIWIAEDNPQAAADVDDRIEAAAQRLKDFPNSGRPGRIEGTRELVIAHTPYIAPYQIIGDTVRV
LRVIHGARMWPHDVPPEFEPE
MKLAWSNRATTDRLAIFIWIAEDNPQAAADVDDRIEAAAQRLKDFPNSGRPGRIEGTRELVIAHTPYIAPYQIIGDTVRV
LRVIHGARMWPHDVPPEFEPE
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|