Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 604213..604800 Replicon chromosome
Accession NZ_CP124576
Organism Sphingobium sp. AP49

Toxin (Protein)


Gene name vapC Uniprot ID J2WNW7
Locus tag PMI04_RS02905 Protein ID WP_007708043.1
Coordinates 604213..604590 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID J2DNW7
Locus tag PMI04_RS02910 Protein ID WP_007708040.1
Coordinates 604603..604800 (-) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMI04_RS02870 (PMI04_002870) 599305..599883 - 579 WP_007708061.1 TMEM165/GDT1 family protein -
PMI04_RS02875 (PMI04_002875) 600119..600535 + 417 WP_007708058.1 DUF1801 domain-containing protein -
PMI04_RS02880 (PMI04_002880) 600543..600947 - 405 WP_007708055.1 hypothetical protein -
PMI04_RS02885 (PMI04_002885) 601059..601619 - 561 WP_037485904.1 hypothetical protein -
PMI04_RS02890 (PMI04_002890) 601635..602189 - 555 WP_007708049.1 demethoxyubiquinone hydroxylase family protein -
PMI04_RS02895 (PMI04_002895) 602186..602680 - 495 WP_007708047.1 disulfide bond formation protein B -
PMI04_RS02900 (PMI04_002900) 602754..604109 - 1356 WP_007708045.1 S41 family peptidase -
PMI04_RS02905 (PMI04_002905) 604213..604590 - 378 WP_007708043.1 type II toxin-antitoxin system VapC family toxin Toxin
PMI04_RS02910 (PMI04_002910) 604603..604800 - 198 WP_007708040.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PMI04_RS02915 (PMI04_002915) 604856..606094 - 1239 WP_037485902.1 peptidoglycan DD-metalloendopeptidase family protein -
PMI04_RS02920 (PMI04_002920) 606152..606574 - 423 WP_007708032.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
PMI04_RS02925 (PMI04_002925) 606628..607017 - 390 WP_007708029.1 ribosome silencing factor -
PMI04_RS02930 (PMI04_002930) 607030..607659 - 630 WP_007708025.1 nicotinate-nucleotide adenylyltransferase -
PMI04_RS02935 (PMI04_002935) 607844..609106 + 1263 WP_238535893.1 TCR/Tet family MFS transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-113)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14209.62 Da        Isoelectric Point: 8.8968

>T280857 WP_007708043.1 NZ_CP124576:c604590-604213 [Sphingobium sp. AP49]
MILADSSIWIDHLRDTDRDMAAMLNAGRILTHPFIIGEIALGSMRNRRTILHMLRRLPEVVQARNAEVDMLIEQIPLFNL
GIGYIDAHLLVSARLTPGSSIWTRDRRLLQAAALLGVDRHMDRPH

Download         Length: 378 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 7079.23 Da        Isoelectric Point: 6.2936

>AT280857 WP_007708040.1 NZ_CP124576:c604800-604603 [Sphingobium sp. AP49]
MRTTLALDDELLAEAQELTGLTEKSALVREALKALIQREAARRLALLGGTEPDLALPPRRRTAIA

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J2WNW7

Antitoxin

Source ID Structure
AlphaFold DB J2DNW7

References