Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF-MazE |
Location | 6406624..6407201 | Replicon | chromosome |
Accession | NZ_CP124543 | ||
Organism | Halotia branconii CENA392 |
Toxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QI031_RS28060 | Protein ID | WP_281482840.1 |
Coordinates | 6406624..6406947 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QI031_RS28065 | Protein ID | WP_281482841.1 |
Coordinates | 6406941..6407201 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI031_RS28045 (QI031_28045) | 6402602..6403030 | - | 429 | WP_281482837.1 | hypothetical protein | - |
QI031_RS28050 (QI031_28050) | 6403554..6404816 | + | 1263 | WP_281482838.1 | hypothetical protein | - |
QI031_RS28055 (QI031_28055) | 6405180..6405854 | - | 675 | WP_281482839.1 | hypothetical protein | - |
QI031_RS28060 (QI031_28060) | 6406624..6406947 | - | 324 | WP_281482840.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QI031_RS28065 (QI031_28065) | 6406941..6407201 | - | 261 | WP_281482841.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QI031_RS28070 (QI031_28070) | 6407473..6408495 | + | 1023 | WP_281482842.1 | saccharopine dehydrogenase-like oxidoreductase | - |
QI031_RS28075 (QI031_28075) | 6408564..6408941 | - | 378 | WP_281482843.1 | four helix bundle protein | - |
QI031_RS28080 (QI031_28080) | 6408978..6409535 | - | 558 | WP_281486144.1 | hypothetical protein | - |
QI031_RS28085 (QI031_28085) | 6409608..6410831 | - | 1224 | WP_281482844.1 | type II secretion system F family protein | - |
QI031_RS28090 (QI031_28090) | 6411030..6412154 | - | 1125 | WP_281482845.1 | type IV pilus twitching motility protein PilT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12061.08 Da Isoelectric Point: 6.2755
>T280851 WP_281482840.1 NZ_CP124543:c6406947-6406624 [Halotia branconii CENA392]
MVVKRFDVFLVNLDPTIGSEIQKTRPCVVISPDEMNRYIATVIVAPMTTKGQVYPTRIACQFQGKDGQIVLDQIRTVDKA
RLIKQLGQISDYEQKAVLDTLAEMFAE
MVVKRFDVFLVNLDPTIGSEIQKTRPCVVISPDEMNRYIATVIVAPMTTKGQVYPTRIACQFQGKDGQIVLDQIRTVDKA
RLIKQLGQISDYEQKAVLDTLAEMFAE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|