Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 5917653..5918202 | Replicon | chromosome |
Accession | NZ_CP124543 | ||
Organism | Halotia branconii CENA392 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QI031_RS25915 | Protein ID | WP_281482457.1 |
Coordinates | 5917864..5918202 (+) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QI031_RS25910 | Protein ID | WP_281482456.1 |
Coordinates | 5917653..5917877 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI031_RS25880 (QI031_25880) | 5913246..5913662 | + | 417 | WP_281482450.1 | XisH family protein | - |
QI031_RS25885 (QI031_25885) | 5913650..5913985 | + | 336 | WP_281482451.1 | XisI protein | - |
QI031_RS25890 (QI031_25890) | 5913932..5914255 | - | 324 | WP_281482452.1 | nucleotidyltransferase domain-containing protein | - |
QI031_RS25895 (QI031_25895) | 5914469..5915011 | + | 543 | WP_281482453.1 | transposase | - |
QI031_RS25900 (QI031_25900) | 5915200..5917062 | - | 1863 | WP_281482454.1 | SUMF1/EgtB/PvdO family nonheme iron enzyme | - |
QI031_RS25905 (QI031_25905) | 5917125..5917508 | - | 384 | WP_281482455.1 | hypothetical protein | - |
QI031_RS25910 (QI031_25910) | 5917653..5917877 | + | 225 | WP_281482456.1 | CopG family transcriptional regulator | Antitoxin |
QI031_RS25915 (QI031_25915) | 5917864..5918202 | + | 339 | WP_281482457.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QI031_RS25920 (QI031_25920) | 5918227..5918541 | - | 315 | WP_281482458.1 | HigA family addiction module antitoxin | - |
QI031_RS25925 (QI031_25925) | 5918553..5918696 | - | 144 | WP_281482459.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QI031_RS25930 (QI031_25930) | 5918902..5919717 | + | 816 | WP_281482460.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
QI031_RS25935 (QI031_25935) | 5919737..5920681 | + | 945 | WP_281482461.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
QI031_RS25940 (QI031_25940) | 5920776..5921087 | + | 312 | WP_281482462.1 | DUF3082 domain-containing protein | - |
QI031_RS25945 (QI031_25945) | 5921093..5921986 | - | 894 | WP_281482463.1 | response regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12309.23 Da Isoelectric Point: 8.5012
>T280850 WP_281482457.1 NZ_CP124543:5917864-5918202 [Halotia branconii CENA392]
MKRGDIYYANLSPAVGSEMDKCRPVLIVSNDANNRAANTVTILPITSNVRRVYPFEVLLNCEDSGLPKASKVQAQQIRTI
SQQRIVGEVINSLSQELMQLVDAALKLHLGIS
MKRGDIYYANLSPAVGSEMDKCRPVLIVSNDANNRAANTVTILPITSNVRRVYPFEVLLNCEDSGLPKASKVQAQQIRTI
SQQRIVGEVINSLSQELMQLVDAALKLHLGIS
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|