Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 5917653..5918202 Replicon chromosome
Accession NZ_CP124543
Organism Halotia branconii CENA392

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag QI031_RS25915 Protein ID WP_281482457.1
Coordinates 5917864..5918202 (+) Length 113 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag QI031_RS25910 Protein ID WP_281482456.1
Coordinates 5917653..5917877 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QI031_RS25880 (QI031_25880) 5913246..5913662 + 417 WP_281482450.1 XisH family protein -
QI031_RS25885 (QI031_25885) 5913650..5913985 + 336 WP_281482451.1 XisI protein -
QI031_RS25890 (QI031_25890) 5913932..5914255 - 324 WP_281482452.1 nucleotidyltransferase domain-containing protein -
QI031_RS25895 (QI031_25895) 5914469..5915011 + 543 WP_281482453.1 transposase -
QI031_RS25900 (QI031_25900) 5915200..5917062 - 1863 WP_281482454.1 SUMF1/EgtB/PvdO family nonheme iron enzyme -
QI031_RS25905 (QI031_25905) 5917125..5917508 - 384 WP_281482455.1 hypothetical protein -
QI031_RS25910 (QI031_25910) 5917653..5917877 + 225 WP_281482456.1 CopG family transcriptional regulator Antitoxin
QI031_RS25915 (QI031_25915) 5917864..5918202 + 339 WP_281482457.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QI031_RS25920 (QI031_25920) 5918227..5918541 - 315 WP_281482458.1 HigA family addiction module antitoxin -
QI031_RS25925 (QI031_25925) 5918553..5918696 - 144 WP_281482459.1 type II toxin-antitoxin system RelE/ParE family toxin -
QI031_RS25930 (QI031_25930) 5918902..5919717 + 816 WP_281482460.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QI031_RS25935 (QI031_25935) 5919737..5920681 + 945 WP_281482461.1 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase -
QI031_RS25940 (QI031_25940) 5920776..5921087 + 312 WP_281482462.1 DUF3082 domain-containing protein -
QI031_RS25945 (QI031_25945) 5921093..5921986 - 894 WP_281482463.1 response regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-108)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 113 a.a.        Molecular weight: 12309.23 Da        Isoelectric Point: 8.5012

>T280850 WP_281482457.1 NZ_CP124543:5917864-5918202 [Halotia branconii CENA392]
MKRGDIYYANLSPAVGSEMDKCRPVLIVSNDANNRAANTVTILPITSNVRRVYPFEVLLNCEDSGLPKASKVQAQQIRTI
SQQRIVGEVINSLSQELMQLVDAALKLHLGIS

Download         Length: 339 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8403.50 Da        Isoelectric Point: 4.1819

>AT280850 WP_281482456.1 NZ_CP124543:5917653-5917877 [Halotia branconii CENA392]
MQVEKLSISLSAPLVRFVESYKLAKGCKSRSQVIEMALQLLREQELEQAYREASAEVDNDWDVTITDGLADEAW

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References