Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/- |
| Location | 5519358..5519967 | Replicon | chromosome |
| Accession | NZ_CP124543 | ||
| Organism | Halotia branconii CENA392 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QI031_RS24235 | Protein ID | WP_281482154.1 |
| Coordinates | 5519358..5519720 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QI031_RS24240 | Protein ID | WP_281482155.1 |
| Coordinates | 5519710..5519967 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QI031_RS24215 (QI031_24215) | 5514470..5517262 | - | 2793 | WP_281482150.1 | preprotein translocase subunit SecA | - |
| QI031_RS24220 (QI031_24220) | 5517844..5518380 | - | 537 | WP_281482151.1 | cytochrome C | - |
| QI031_RS24225 (QI031_24225) | 5518675..5519028 | - | 354 | WP_281482152.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QI031_RS24230 (QI031_24230) | 5519018..5519275 | - | 258 | WP_281482153.1 | hypothetical protein | - |
| QI031_RS24235 (QI031_24235) | 5519358..5519720 | - | 363 | WP_281482154.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QI031_RS24240 (QI031_24240) | 5519710..5519967 | - | 258 | WP_281482155.1 | hypothetical protein | Antitoxin |
| QI031_RS24245 (QI031_24245) | 5520154..5520918 | + | 765 | WP_281482156.1 | glycosyltransferase family A protein | - |
| QI031_RS24250 (QI031_24250) | 5520939..5522597 | + | 1659 | WP_281482157.1 | hormogonium polysaccharide biosynthesis protein HpsL | - |
| QI031_RS24255 (QI031_24255) | 5522712..5523701 | + | 990 | WP_281482158.1 | hormogonium polysaccharide biosynthesis glycosyltransferase HpsN | - |
| QI031_RS24260 (QI031_24260) | 5523773..5524954 | + | 1182 | WP_281486112.1 | hormogonium polysaccharide biosynthesis glycosyltransferase HpsO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13978.77 Da Isoelectric Point: 4.7783
>T280849 WP_281482154.1 NZ_CP124543:c5519720-5519358 [Halotia branconii CENA392]
MQSDEAVIIRFSDEFEEELYRLSKRFRNIRSDVQPIIEQLQQGNIIGDRIAGIGEEYIVYKVRVRNSNIQKGKSAGYCLI
YQVESPTTILLLTIYSKSDREDIGTNEIRDIVADFYHKQD
MQSDEAVIIRFSDEFEEELYRLSKRFRNIRSDVQPIIEQLQQGNIIGDRIAGIGEEYIVYKVRVRNSNIQKGKSAGYCLI
YQVESPTTILLLTIYSKSDREDIGTNEIRDIVADFYHKQD
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|