Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
Location | 5512422..5512984 | Replicon | chromosome |
Accession | NZ_CP124543 | ||
Organism | Halotia branconii CENA392 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QI031_RS24205 | Protein ID | WP_281482148.1 |
Coordinates | 5512643..5512984 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QI031_RS24200 | Protein ID | WP_281482147.1 |
Coordinates | 5512422..5512646 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI031_RS24175 (QI031_24175) | 5508421..5508915 | + | 495 | WP_281482142.1 | hypothetical protein | - |
QI031_RS24180 (QI031_24180) | 5509344..5510039 | + | 696 | WP_281482143.1 | pentapeptide repeat-containing protein | - |
QI031_RS24185 (QI031_24185) | 5510159..5510983 | + | 825 | WP_281482144.1 | SDR family oxidoreductase | - |
QI031_RS24190 (QI031_24190) | 5511006..5511902 | + | 897 | WP_281482145.1 | alpha/beta hydrolase | - |
QI031_RS24195 (QI031_24195) | 5511909..5512250 | - | 342 | WP_281482146.1 | thioredoxin | - |
QI031_RS24200 (QI031_24200) | 5512422..5512646 | + | 225 | WP_281482147.1 | DUF433 domain-containing protein | Antitoxin |
QI031_RS24205 (QI031_24205) | 5512643..5512984 | + | 342 | WP_281482148.1 | DUF5615 family PIN-like protein | Toxin |
QI031_RS24210 (QI031_24210) | 5513073..5513750 | + | 678 | WP_281482149.1 | polysaccharide deacetylase family protein | - |
QI031_RS24215 (QI031_24215) | 5514470..5517262 | - | 2793 | WP_281482150.1 | preprotein translocase subunit SecA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12312.14 Da Isoelectric Point: 4.1232
>T280846 WP_281482148.1 NZ_CP124543:5512643-5512984 [Halotia branconii CENA392]
MTTIWIDVHLSPAIASWITNTFGVTAIALRDLGLRDAEDPKIFEAAKAERAIFMTKDSDFVDLVDRLGVPPQIIWLTCGN
TSNARLQEILASTLLEALALLSTGEQLVEISGD
MTTIWIDVHLSPAIASWITNTFGVTAIALRDLGLRDAEDPKIFEAAKAERAIFMTKDSDFVDLVDRLGVPPQIIWLTCGN
TSNARLQEILASTLLEALALLSTGEQLVEISGD
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|