Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 4389019..4389555 | Replicon | chromosome |
Accession | NZ_CP124543 | ||
Organism | Halotia branconii CENA392 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QI031_RS19320 | Protein ID | WP_281481276.1 |
Coordinates | 4389019..4389318 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | QI031_RS19325 | Protein ID | WP_281481277.1 |
Coordinates | 4389322..4389555 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI031_RS19300 (QI031_19300) | 4384596..4385051 | - | 456 | WP_281481272.1 | transcriptional repressor | - |
QI031_RS19305 (QI031_19305) | 4385826..4386029 | + | 204 | WP_281481273.1 | ChaB family protein | - |
QI031_RS19310 (QI031_19310) | 4386056..4387495 | - | 1440 | WP_281481274.1 | FAD-binding domain-containing protein | - |
QI031_RS19315 (QI031_19315) | 4387634..4388539 | - | 906 | WP_281481275.1 | LD-carboxypeptidase | - |
QI031_RS19320 (QI031_19320) | 4389019..4389318 | - | 300 | WP_281481276.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QI031_RS19325 (QI031_19325) | 4389322..4389555 | - | 234 | WP_281481277.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QI031_RS19330 (QI031_19330) | 4390352..4393477 | + | 3126 | WP_281481278.1 | zinc-dependent metalloprotease | - |
QI031_RS19335 (QI031_19335) | 4393690..4394220 | + | 531 | WP_281481279.1 | PEP-CTERM sorting domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11990.70 Da Isoelectric Point: 7.9186
>T280845 WP_281481276.1 NZ_CP124543:c4389318-4389019 [Halotia branconii CENA392]
MSLFRLTELAKQDLLSIGRYTQKTWGIEQRNRYLTMLDDCFQILARNPHKGRACDEISPGYRKYHIGRHLIFYRETDEYI
DIVRILHDRMDIESHFNKD
MSLFRLTELAKQDLLSIGRYTQKTWGIEQRNRYLTMLDDCFQILARNPHKGRACDEISPGYRKYHIGRHLIFYRETDEYI
DIVRILHDRMDIESHFNKD
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|