Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 4137138..4137750 | Replicon | chromosome |
Accession | NZ_CP124543 | ||
Organism | Halotia branconii CENA392 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QI031_RS18185 | Protein ID | WP_281481066.1 |
Coordinates | 4137138..4137515 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QI031_RS18190 | Protein ID | WP_281481067.1 |
Coordinates | 4137508..4137750 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI031_RS18155 (QI031_18155) | 4132796..4133008 | + | 213 | WP_281481060.1 | hypothetical protein | - |
QI031_RS18160 (QI031_18160) | 4133075..4133962 | - | 888 | WP_281481061.1 | site-specific DNA-methyltransferase | - |
QI031_RS18165 (QI031_18165) | 4134140..4135666 | - | 1527 | WP_281481062.1 | ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit B | - |
QI031_RS18170 (QI031_18170) | 4136100..4136309 | - | 210 | WP_281481063.1 | hypothetical protein | - |
QI031_RS18175 (QI031_18175) | 4136445..4137026 | - | 582 | WP_281481064.1 | Uma2 family endonuclease | - |
QI031_RS18180 (QI031_18180) | 4137023..4137160 | - | 138 | WP_281481065.1 | hypothetical protein | - |
QI031_RS18185 (QI031_18185) | 4137138..4137515 | - | 378 | WP_281481066.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QI031_RS18190 (QI031_18190) | 4137508..4137750 | - | 243 | WP_281481067.1 | hypothetical protein | Antitoxin |
QI031_RS18195 (QI031_18195) | 4137768..4139930 | - | 2163 | WP_281481068.1 | N-6 DNA methylase | - |
QI031_RS18200 (QI031_18200) | 4139987..4141336 | - | 1350 | WP_281481069.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
QI031_RS18205 (QI031_18205) | 4141518..4141643 | + | 126 | WP_281481070.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.21 Da Isoelectric Point: 9.7522
>T280844 WP_281481066.1 NZ_CP124543:c4137515-4137138 [Halotia branconii CENA392]
MVDQPLIQVQASPTFKRNIRALAKKYRSIRNDIQPVIEQLQQGELSGDQIPGVGYAIFKLRVRNSDAQKGKSGGYRLIYY
VKTATGIILLTVYTKSKQVDIAAKDIQSIIAEYEQQTINDEERDI
MVDQPLIQVQASPTFKRNIRALAKKYRSIRNDIQPVIEQLQQGELSGDQIPGVGYAIFKLRVRNSDAQKGKSGGYRLIYY
VKTATGIILLTVYTKSKQVDIAAKDIQSIIAEYEQQTINDEERDI
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|