Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-yefM/YoeB-RelB |
Location | 3947821..3948334 | Replicon | chromosome |
Accession | NZ_CP124543 | ||
Organism | Halotia branconii CENA392 |
Toxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QI031_RS17295 | Protein ID | WP_281480896.1 |
Coordinates | 3948068..3948334 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | QI031_RS17290 | Protein ID | WP_281480895.1 |
Coordinates | 3947821..3948075 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI031_RS17265 (QI031_17265) | 3943343..3943606 | - | 264 | WP_281480890.1 | hypothetical protein | - |
QI031_RS17270 (QI031_17270) | 3943672..3944628 | - | 957 | WP_281480891.1 | hypothetical protein | - |
QI031_RS17275 (QI031_17275) | 3944660..3945553 | - | 894 | WP_281480892.1 | tetratricopeptide repeat protein | - |
QI031_RS17280 (QI031_17280) | 3945550..3946410 | - | 861 | WP_281480893.1 | hypothetical protein | - |
QI031_RS17285 (QI031_17285) | 3946329..3947237 | - | 909 | WP_281480894.1 | SAM-dependent methyltransferase | - |
QI031_RS17290 (QI031_17290) | 3947821..3948075 | + | 255 | WP_281480895.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QI031_RS17295 (QI031_17295) | 3948068..3948334 | + | 267 | WP_281480896.1 | Txe/YoeB family addiction module toxin | Toxin |
QI031_RS17300 (QI031_17300) | 3948414..3949781 | - | 1368 | WP_281480897.1 | AAA-like domain-containing protein | - |
QI031_RS17305 (QI031_17305) | 3950017..3950370 | + | 354 | WP_281480898.1 | hypothetical protein | - |
QI031_RS17310 (QI031_17310) | 3950956..3951192 | - | 237 | WP_281480899.1 | DUF4327 family protein | - |
QI031_RS17315 (QI031_17315) | 3951787..3951960 | - | 174 | WP_281480900.1 | hypothetical protein | - |
QI031_RS17320 (QI031_17320) | 3952093..3953280 | - | 1188 | WP_281480901.1 | serine/threonine protein kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10645.16 Da Isoelectric Point: 6.9759
>T280843 WP_281480896.1 NZ_CP124543:3948068-3948334 [Halotia branconii CENA392]
MTRKLAWTDEAWNDYLYWQGQDKKILKRINKLIEATIQLPFEGIGKPELLRENLAGFWSRRIDDTNRLVYAVNDEYLTII
SCRYHYFD
MTRKLAWTDEAWNDYLYWQGQDKKILKRINKLIEATIQLPFEGIGKPELLRENLAGFWSRRIDDTNRLVYAVNDEYLTII
SCRYHYFD
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|