Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) EcnAB/-
Location 4694661..4695024 Replicon chromosome
Accession NZ_CP124534
Organism Xanthomonas campestris strain DX

Toxin (Protein)


Gene name EcnB Uniprot ID G0CKD4
Locus tag QJS70_RS20775 Protein ID WP_011270059.1
Coordinates 4694661..4694795 (-) Length 45 a.a.

Antitoxin (Protein)


Gene name EcnA Uniprot ID Q8P3Z2
Locus tag QJS70_RS20780 Protein ID WP_011038999.1
Coordinates 4694872..4695024 (-) Length 51 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJS70_RS20755 4689927..4691579 - 1653 WP_172973909.1 M28 family metallopeptidase -
QJS70_RS20760 4691743..4692687 - 945 WP_172973853.1 MBL fold metallo-hydrolase -
QJS70_RS20765 4692771..4694060 - 1290 WP_172973854.1 tryptophan--tRNA ligase -
QJS70_RS20770 4694220..4694429 - 210 WP_011038998.1 CsbD family protein -
QJS70_RS20775 4694661..4694795 - 135 WP_011270059.1 entericidin A/B family lipoprotein Toxin
QJS70_RS20780 4694872..4695024 - 153 WP_011038999.1 entericidin A/B family lipoprotein Antitoxin
QJS70_RS20785 4695135..4696058 - 924 Protein_4023 arginase -
QJS70_RS20790 4696372..4696833 + 462 WP_011039001.1 roadblock/LC7 domain-containing protein -
QJS70_RS20795 4696916..4697275 + 360 WP_011039002.1 hypothetical protein -
QJS70_RS20800 4697378..4698295 + 918 WP_011039003.1 hypothetical protein -
QJS70_RS20805 4698292..4698834 + 543 WP_011039004.1 GTPase -
QJS70_RS20810 4699169..4699852 + 684 WP_011039005.1 dTMP kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Entericidin A/B

(23-42)

Antitoxin

Entericidin A/B

(23-42)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4431.27 Da        Isoelectric Point: 9.3487

>T280840 WP_011270059.1 NZ_CP124534:c4694795-4694661 [Xanthomonas campestris]
MKRAIALLVLSMLSVGMLAGCNTVAGAGKDVQGAGEKVEDAARK

Download         Length: 135 bp

Antitoxin


Download         Length: 51 a.a.        Molecular weight: 5173.15 Da        Isoelectric Point: 8.2782

>AT280840 WP_011038999.1 NZ_CP124534:c4695024-4694872 [Xanthomonas campestris]
MKRLLTLMVLGLFSAGMMTGCNTMAGAGKDMQGAGDKVEKTADKCSDGKC

Download         Length: 153 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2XDQ0

Antitoxin

Source ID Structure
AlphaFold DB Q8P3Z2

References