Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1234210..1234988 | Replicon | chromosome |
Accession | NZ_CP124534 | ||
Organism | Xanthomonas campestris strain DX |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | Q8P667 |
Locus tag | QJS70_RS05235 | Protein ID | WP_011038220.1 |
Coordinates | 1234210..1234701 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | Q8P668 |
Locus tag | QJS70_RS05240 | Protein ID | WP_011038219.1 |
Coordinates | 1234698..1234988 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJS70_RS05215 | 1230461..1231336 | + | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
QJS70_RS05220 | 1231559..1232032 | + | 474 | WP_012437597.1 | hypothetical protein | - |
QJS70_RS05225 | 1232063..1232740 | + | 678 | WP_003490678.1 | response regulator transcription factor | - |
QJS70_RS05230 | 1232733..1234067 | + | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
QJS70_RS05235 | 1234210..1234701 | - | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
QJS70_RS05240 | 1234698..1234988 | - | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
QJS70_RS05245 | 1235063..1235464 | - | 402 | WP_019237348.1 | SymE family type I addiction module toxin | - |
QJS70_RS05250 | 1235996..1236619 | - | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
QJS70_RS05255 | 1236633..1237496 | - | 864 | WP_011038216.1 | A24 family peptidase | - |
QJS70_RS05260 | 1237503..1238759 | - | 1257 | WP_011038215.1 | type II secretion system F family protein | - |
QJS70_RS05265 | 1239086..1239526 | + | 441 | WP_011038214.1 | pilin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1192416..1237796 | 45380 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T280839 WP_011038220.1 NZ_CP124534:c1234701-1234210 [Xanthomonas campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|