Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1234220..1234998 | Replicon | chromosome |
Accession | NZ_CP124533 | ||
Organism | Xanthomonas campestris strain JN |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | Q8P667 |
Locus tag | QJS72_RS05225 | Protein ID | WP_011038220.1 |
Coordinates | 1234220..1234711 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | Q8P668 |
Locus tag | QJS72_RS05230 | Protein ID | WP_011038219.1 |
Coordinates | 1234708..1234998 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJS72_RS05205 | 1230471..1231346 | + | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
QJS72_RS05210 | 1231569..1232042 | + | 474 | WP_012437597.1 | hypothetical protein | - |
QJS72_RS05215 | 1232073..1232750 | + | 678 | WP_003490678.1 | response regulator transcription factor | - |
QJS72_RS05220 | 1232743..1234077 | + | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
QJS72_RS05225 | 1234220..1234711 | - | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
QJS72_RS05230 | 1234708..1234998 | - | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
QJS72_RS05235 | 1235073..1235474 | - | 402 | WP_019237348.1 | SymE family type I addiction module toxin | - |
QJS72_RS05240 | 1236006..1236629 | - | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
QJS72_RS05245 | 1236643..1237506 | - | 864 | WP_011038216.1 | A24 family peptidase | - |
QJS72_RS05250 | 1237513..1238769 | - | 1257 | WP_011038215.1 | type II secretion system F family protein | - |
QJS72_RS05255 | 1239096..1239536 | + | 441 | WP_011038214.1 | pilin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1192426..1237806 | 45380 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T280837 WP_011038220.1 NZ_CP124533:c1234711-1234220 [Xanthomonas campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|