Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1235358..1236136 | Replicon | chromosome |
| Accession | NZ_CP124531 | ||
| Organism | Xanthomonas campestris strain TJ | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | Q8P667 |
| Locus tag | QJS71_RS05245 | Protein ID | WP_011038220.1 |
| Coordinates | 1235358..1235849 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | Q8P668 |
| Locus tag | QJS71_RS05250 | Protein ID | WP_011038219.1 |
| Coordinates | 1235846..1236136 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJS71_RS05225 | 1231609..1232484 | + | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| QJS71_RS05230 | 1232707..1233180 | + | 474 | WP_012437597.1 | hypothetical protein | - |
| QJS71_RS05235 | 1233211..1233888 | + | 678 | WP_003490678.1 | response regulator transcription factor | - |
| QJS71_RS05240 | 1233881..1235215 | + | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
| QJS71_RS05245 | 1235358..1235849 | - | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
| QJS71_RS05250 | 1235846..1236136 | - | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
| QJS71_RS05255 | 1236211..1236612 | - | 402 | WP_019237348.1 | SymE family type I addiction module toxin | - |
| QJS71_RS05260 | 1237144..1237767 | - | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
| QJS71_RS05265 | 1237781..1238644 | - | 864 | WP_011038216.1 | A24 family peptidase | - |
| QJS71_RS05270 | 1238651..1239907 | - | 1257 | WP_011038215.1 | type II secretion system F family protein | - |
| QJS71_RS05275 | 1240234..1240674 | + | 441 | WP_011038214.1 | pilin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1192357..1238944 | 46587 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T280835 WP_011038220.1 NZ_CP124531:c1235849-1235358 [Xanthomonas campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|