Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1243452..1244230 | Replicon | chromosome |
Accession | NZ_CP124530 | ||
Organism | Xanthomonas campestris strain YX |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | Q8P667 |
Locus tag | QJS69_RS05295 | Protein ID | WP_011038220.1 |
Coordinates | 1243452..1243943 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | Q8P668 |
Locus tag | QJS69_RS05300 | Protein ID | WP_011038219.1 |
Coordinates | 1243940..1244230 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJS69_RS05275 | 1239703..1240578 | + | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
QJS69_RS05280 | 1240801..1241274 | + | 474 | WP_012437597.1 | hypothetical protein | - |
QJS69_RS05285 | 1241305..1241982 | + | 678 | WP_003490678.1 | response regulator transcription factor | - |
QJS69_RS05290 | 1241975..1243309 | + | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
QJS69_RS05295 | 1243452..1243943 | - | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
QJS69_RS05300 | 1243940..1244230 | - | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
QJS69_RS05305 | 1244305..1244706 | - | 402 | WP_012437599.1 | SymE family type I addiction module toxin | - |
QJS69_RS05310 | 1245238..1245861 | - | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
QJS69_RS05315 | 1245875..1246738 | - | 864 | WP_012437600.1 | A24 family peptidase | - |
QJS69_RS05320 | 1246745..1248004 | - | 1260 | WP_012437601.1 | type II secretion system F family protein | - |
QJS69_RS05325 | 1248356..1248769 | + | 414 | WP_012437602.1 | pilin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T280833 WP_011038220.1 NZ_CP124530:c1243943-1243452 [Xanthomonas campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|