Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelB-YoeB |
| Location | 24346..24887 | Replicon | plasmid pWB2 |
| Accession | NZ_CP124527 | ||
| Organism | Psychrobacter sp. WB2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QJS82_RS13575 | Protein ID | WP_087813576.1 |
| Coordinates | 24346..24636 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QJS82_RS13580 | Protein ID | WP_087813577.1 |
| Coordinates | 24633..24887 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJS82_RS13545 (QJS82_13545) | 20107..20580 | + | 474 | WP_000777554.1 | trimethoprim-resistant dihydrofolate reductase DfrA1 | - |
| QJS82_RS13550 (QJS82_13550) | 20675..21199 | + | 525 | WP_000704156.1 | streptothricin N-acetyltransferase Sat2 | - |
| QJS82_RS13555 (QJS82_13555) | 21257..22092 | + | 836 | Protein_23 | ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 | - |
| QJS82_RS13560 (QJS82_13560) | 22121..22618 | + | 498 | WP_001444089.1 | hypothetical protein | - |
| QJS82_RS13565 (QJS82_13565) | 22679..23050 | + | 372 | WP_000119696.1 | hypothetical protein | - |
| QJS82_RS13570 (QJS82_13570) | 23460..23654 | + | 195 | Protein_26 | hypothetical protein | - |
| QJS82_RS13575 (QJS82_13575) | 24346..24636 | + | 291 | WP_087813576.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Toxin |
| QJS82_RS13580 (QJS82_13580) | 24633..24887 | + | 255 | WP_087813577.1 | Txe/YoeB family addiction module toxin | Antitoxin |
| QJS82_RS13585 (QJS82_13585) | 26065..27033 | - | 969 | WP_281491739.1 | DNA-binding protein | - |
| QJS82_RS13590 (QJS82_13590) | 27292..27456 | - | 165 | WP_156410068.1 | hypothetical protein | - |
| QJS82_RS13595 (QJS82_13595) | 27443..27731 | - | 289 | Protein_31 | BrnT family toxin | - |
| QJS82_RS13600 (QJS82_13600) | 27728..27955 | - | 228 | WP_058368521.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| QJS82_RS13605 (QJS82_13605) | 28039..28995 | - | 957 | WP_058368520.1 | replication initiation protein | - |
| QJS82_RS13610 (QJS82_13610) | 29322..29492 | - | 171 | WP_156410067.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul2 / floR / dfrA1 / ant(3'')-Ia | - | 1..44871 | 44871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10960.45 Da Isoelectric Point: 4.8948
>T280831 WP_087813576.1 NZ_CP124527:24346-24636 [Psychrobacter sp. WB2]
MDVVNYTDFRKSLAKYIDKVDTDKGPILITRQNAKPTVLMSLEEFNSYEETLHLLSSPTNAKRLRRSIADAKAGRLIERE
IDAKDMPLTFDDEVDA
MDVVNYTDFRKSLAKYIDKVDTDKGPILITRQNAKPTVLMSLEEFNSYEETLHLLSSPTNAKRLRRSIADAKAGRLIERE
IDAKDMPLTFDDEVDA
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|