Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YefM |
| Location | 960263..960791 | Replicon | chromosome |
| Accession | NZ_CP124526 | ||
| Organism | Psychrobacter sp. WB2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QJS82_RS04050 | Protein ID | WP_281491304.1 |
| Coordinates | 960263..960550 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QJS82_RS04055 | Protein ID | WP_281491305.1 |
| Coordinates | 960540..960791 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJS82_RS04025 (QJS82_04025) | 955342..956199 | - | 858 | WP_281491301.1 | Nif3-like dinuclear metal center hexameric protein | - |
| QJS82_RS04030 (QJS82_04030) | 956667..957995 | + | 1329 | WP_201624331.1 | trypsin-like peptidase domain-containing protein | - |
| QJS82_RS04035 (QJS82_04035) | 958196..958462 | - | 267 | WP_183617826.1 | class I ribonucleotide reductase maintenance protein YfaE | - |
| QJS82_RS04040 (QJS82_04040) | 958658..959791 | - | 1134 | WP_281491302.1 | class Ia ribonucleoside-diphosphate reductase subunit beta | - |
| QJS82_RS04045 (QJS82_04045) | 959869..960240 | - | 372 | WP_281491303.1 | hypothetical protein | - |
| QJS82_RS04050 (QJS82_04050) | 960263..960550 | - | 288 | WP_281491304.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| QJS82_RS04055 (QJS82_04055) | 960540..960791 | - | 252 | WP_281491305.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QJS82_RS04060 (QJS82_04060) | 960917..961450 | - | 534 | WP_281491306.1 | hypothetical protein | - |
| QJS82_RS04065 (QJS82_04065) | 961574..963850 | - | 2277 | WP_281491307.1 | class 1a ribonucleoside-diphosphate reductase subunit alpha | - |
| QJS82_RS04070 (QJS82_04070) | 964403..964783 | - | 381 | WP_281491308.1 | DUF493 domain-containing protein | - |
| QJS82_RS04075 (QJS82_04075) | 964911..965609 | - | 699 | WP_281491309.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11015.94 Da Isoelectric Point: 10.6783
>T280830 WP_281491304.1 NZ_CP124526:c960550-960263 [Psychrobacter sp. WB2]
MTYNLEFHPLALKEWKKLAPSIQQQFKKKLQQRLASPRVPASKLSGHTDAYKIKLRTIGYRLVYTVKDDVVVVYVLAVGK
RENNKVYESLVSRQP
MTYNLEFHPLALKEWKKLAPSIQQQFKKKLQQRLASPRVPASKLSGHTDAYKIKLRTIGYRLVYTVKDDVVVVYVLAVGK
RENNKVYESLVSRQP
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|