Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4185494..4186275 | Replicon | chromosome |
Accession | NZ_CP124522 | ||
Organism | Salmonella enterica strain PNUSAS118467 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | QJS74_RS20470 | Protein ID | WP_000626100.1 |
Coordinates | 4185494..4185985 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | QJS74_RS20475 | Protein ID | WP_001110452.1 |
Coordinates | 4185982..4186275 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJS74_RS20435 (4180954) | 4180954..4181301 | + | 348 | WP_050953799.1 | divalent cation tolerance protein CutA | - |
QJS74_RS20440 (4181277) | 4181277..4182980 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
QJS74_RS20445 (4183017) | 4183017..4183592 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
QJS74_RS20455 (4183863) | 4183863..4183937 | - | 75 | Protein_3997 | helix-turn-helix domain-containing protein | - |
QJS74_RS20460 (4184317) | 4184317..4184394 | + | 78 | Protein_3998 | porin family protein | - |
QJS74_RS20465 (4184494) | 4184494..4185246 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
QJS74_RS20470 (4185494) | 4185494..4185985 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
QJS74_RS20475 (4185982) | 4185982..4186275 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
QJS74_RS20480 (4186592) | 4186592..4186813 | + | 222 | WP_001576552.1 | hypothetical protein | - |
QJS74_RS20485 (4187079) | 4187079..4187954 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
QJS74_RS20490 (4187951) | 4187951..4188238 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
QJS74_RS20495 (4188231) | 4188231..4188539 | - | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
QJS74_RS20500 (4188538) | 4188538..4188786 | + | 249 | Protein_4006 | Ig-like domain-containing protein | - |
QJS74_RS20505 (4188898) | 4188898..4189029 | + | 132 | Protein_4007 | hypothetical protein | - |
QJS74_RS20510 (4189323) | 4189323..4190228 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T280827 WP_000626100.1 NZ_CP124522:c4185985-4185494 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1DGA4 |