Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 116608..117209 Replicon plasmid pAVS0343-A
Accession NZ_CP124518
Organism Escherichia coli strain AVS0343

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJB09_RS25200 Protein ID WP_001216034.1
Coordinates 116829..117209 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJB09_RS25195 Protein ID WP_001190712.1
Coordinates 116608..116829 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB09_RS25185 (113601) 113601..114872 - 1272 WP_023142242.1 restriction endonuclease subunit S -
QJB09_RS25190 (114869) 114869..116425 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
QJB09_RS25195 (116608) 116608..116829 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJB09_RS25200 (116829) 116829..117209 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJB09_RS25205 (117214) 117214..117393 + 180 WP_001513661.1 hypothetical protein -
QJB09_RS25210 (117421) 117421..117699 + 279 Protein_132 pdcB -
QJB09_RS25215 (117704) 117704..118117 + 414 Protein_133 integrase core domain-containing protein -
QJB09_RS25220 (118067) 118067..118402 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJB09_RS25225 (118612) 118612..119592 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJB09_RS25230 (119836) 119836..121239 + 1404 WP_001373486.1 S-methylmethionine permease -
QJB09_RS25235 (121226) 121226..122158 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 senB 1..125500 125500


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280809 WP_001216034.1 NZ_CP124518:116829-117209 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280809 WP_001190712.1 NZ_CP124518:116608-116829 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References