Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 106151..106676 | Replicon | plasmid pAVS0343-A |
Accession | NZ_CP124518 | ||
Organism | Escherichia coli strain AVS0343 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QJB09_RS25155 | Protein ID | WP_001159868.1 |
Coordinates | 106151..106456 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QJB09_RS25160 | Protein ID | WP_000813634.1 |
Coordinates | 106458..106676 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB09_RS25140 (102061) | 102061..103227 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QJB09_RS25145 (103815) | 103815..104570 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QJB09_RS25150 (105344) | 105344..106150 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QJB09_RS25155 (106151) | 106151..106456 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QJB09_RS25160 (106458) | 106458..106676 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QJB09_RS25165 (107384) | 107384..108379 | + | 996 | WP_000246636.1 | hypothetical protein | - |
QJB09_RS25170 (108422) | 108422..109315 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..125500 | 125500 | |
- | flank | IS/Tn | - | - | 109452..109955 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280808 WP_001159868.1 NZ_CP124518:c106456-106151 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|